KEGG   Streptomyces collinus: B446_31275Help
Entry
B446_31275        CDS       T02787                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
sci  Streptomyces collinus
Pathway
sci00020  Citrate cycle (TCA cycle)
sci00480  Glutathione metabolism
sci01100  Metabolic pathways
sci01110  Biosynthesis of secondary metabolites
sci01120  Microbial metabolism in diverse environments
sci01130  Biosynthesis of antibiotics
sci01200  Carbon metabolism
sci01210  2-Oxocarboxylic acid metabolism
sci01230  Biosynthesis of amino acids
Module
sci_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sci_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:sci00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    B446_31275
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    B446_31275
Enzymes [BR:sci01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     B446_31275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: AGS73059
UniProt: S5VCX6
LinkDB All DBs
Position
complement(7230735..7232954)
Genome map
AA seq 739 aa AA seqDB search
MTDSTIIYTYTDEAPALATHSFLPVIQAYASQAGVPVTTRDISLAGRIIAVFPEYLNEDQ
RIPDALSELGELAKTPAANIIKLPNISASIPQLKAAVAELQGKGYALPDYPDDPKTDEER
EIRARYDKIKGSAVNPVLREGNSDRRAPASVKNYAKTHPHRMGAWSSDSKTNVATMGVDD
FRSTEKSVVISEAGALRIELKGDDGSTTVLRESVPVLEGEVVDASVMRVAALREFLTAQV
ARAKEEGVLFSVHLKATMMKVSDPIVFGHVVRAFFPKTFAKYGETFAAAGLTPNDGLGGI
FKGIESLPEGAEIKASFDAELAEGPALAMVDSDKGITNLHVPSDVIVDASMPAMIRTSGH
MWGPDGQEADTLAVLPDSSYAGVYQAVIEDCRAHGAYDPSTMGSVPNVGLMAQKAEEYGS
HDKTFEIPVTGTVRLVDQAGNVVIEQTVSAGDIFRACQTKDAPIKDWVKLAVTRARATGD
PAVFWLDETRAHDANLIGKVKQYLAEHDTEGLDIRVLAPVEATKLSVERIRRGENTISVT
GNVLRDYLTDLFPILELGTSAKMLSVVPLMAGGGLFETGAGGSAPKHVQQLVKENYLRWD
SLGEFFALVPSFEQYATATGNTRAKVLADTLDRATATFLNEDKSPTRRVGGIDNRGSHFY
LSLYWAQELAAQTDDADLAKAFGAFAENLAANEQTIVDELIAVQGKPADIGGYYRPEKAK
ADAVMRPSATWNEALASLS
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
gtgactgactcgaccatcatctacacctacacagacgaggccccggccctggcgacgcat
tcgttcctgccggtgatccaggcgtacgcctcgcaggccggtgtgcccgtcacgacccgc
gacatctcgctggccgggcgcatcatcgccgtcttcccggagtacctgaacgaggaccag
cgcatcccggacgcgctgagcgagctgggcgagctggccaagacgcccgccgccaacatc
atcaagctgccgaacatctcggcgtccatcccgcagctcaaggccgccgtcgccgagctc
cagggcaagggctacgcgctgccggactacccggacgacccgaagaccgacgaggagcgc
gagatccgcgcccgctacgacaagatcaagggctccgccgtcaatccggtgctgcgcgag
ggcaactccgaccgccgcgcccccgcctcggtcaagaactacgccaagacccacccgcac
cgcatgggcgcctggagctccgactccaagaccaacgtggccaccatgggcgtggacgac
ttccgctccaccgagaagtccgtggtgatctccgaggccggcgcgctgcgcatcgagctc
aagggcgacgacggctccaccaccgtgctgcgcgagtccgtgccggtgctcgagggcgag
gtcgtcgacgcctccgtgatgcgggtcgccgcgctgcgcgagttcctgaccgcgcaggtc
gcccgcgccaaggaggagggcgtcctgttctccgtgcacctcaaggccacgatgatgaag
gtctccgacccgatcgtcttcggccacgtcgtgcgcgccttcttcccgaagacgttcgcg
aagtacggcgagaccttcgccgccgccggcctgaccccgaacgacggcctgggcggcatc
ttcaaggggatcgagtccctgccggagggcgccgagatcaaggcctccttcgacgccgag
ctggccgagggccccgcgctggccatggtcgactccgacaagggcatcaccaacctgcac
gtgccgtccgacgtcatcgtcgacgcctcgatgccggccatgatccgcacctccggccac
atgtggggcccggacggccaggaggccgacaccctcgcggtgctgccggactcctcctac
gccggtgtctaccaggccgtgatcgaggactgccgcgcccacggcgcctacgacccgtcg
accatgggctccgtcccgaacgtcggcctcatggcgcagaaggccgaggagtacggcagc
cacgacaagaccttcgagatcccggtcaccggcaccgtccgcctggtcgaccaggccggc
aacgtcgtgatcgagcagaccgtctccgccggcgacatcttccgcgcctgccagaccaag
gacgccccgatcaaggactgggtgaagctcgccgtcacccgcgcccgcgccaccggcgac
ccggccgtgttctggctggacgagacccgcgcgcacgacgccaacctgatcggcaaggtc
aagcagtacctggcggagcacgacaccgagggcctggacatccgcgtcctcgccccggtc
gaggccaccaagctgtcggtggagcgcatccgccgcggcgagaacaccatctcggtgacc
ggcaacgtgctgcgcgactacctgaccgacctcttccccatcctggagctgggcaccagc
gccaagatgctgtcggtcgtcccgctgatggcgggcggcggcctgttcgagacgggtgcc
ggcggctccgcgccgaagcacgtccagcagctcgtcaaggagaactacctgcgctgggac
tcgctcggtgagttcttcgccctggtgccgtccttcgagcagtacgcgacggccaccggc
aacacccgcgccaaggtgctggccgacaccctcgaccgcgccacggcgaccttcctcaac
gaggacaagtccccgacccgtcgcgtcggcggcatcgacaaccgcggcagccacttctac
ctgtccctgtactgggcgcaggagctggcggcgcagaccgacgacgccgacctggccaag
gcgttcggcgcgttcgccgagaacctcgccgcgaacgagcagaccatcgtcgacgagctg
atcgccgtccagggcaagccggccgacatcggcggctactaccggccggagaaggcgaag
gcggacgcggtcatgcgcccgtcggccacctggaacgaggctctcgcttccctgagctga

DBGET integrated database retrieval system