KEGG   Sorangium cellulosum So ce56: sce0602Help
Entry
sce0602           CDS       T00634                                 

Gene name
gst2
Definition
(GenBank) Conserved hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
scl  Sorangium cellulosum So ce56
Pathway
scl00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:scl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    sce0602 (gst2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:scl02000]
    sce0602 (gst2)
Enzymes [BR:scl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     sce0602 (gst2)
Transporters [BR:scl02000]
 Other Transporters
  Pores ion channels [TC:1]
   sce0602 (gst2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 GST_C_3 GST_C_5 Glutaredoxin GST_C
Motif
Other DBs
NCBI-ProteinID: CAN90759
UniProt: A9GVI1
LinkDB All DBs
Position
complement(857356..858057)
Genome map
AA seq 233 aa AA seqDB search
MAHAIKENRMTKLRLYSAKACPFAHRTRLVLQEKAIDFELTEVDLQNKPRAFVDASLYGK
VPAIEHEGHRIWESAIINEYLEEVFPEPRLLPREPGRRALARIWIDYANTRLVPAFTQLL
RAETRDQEAAGRKALGDVLAFIEREALARSSGQGPYWLGAEVSLVDVSFYPWFERLPAVG
RLRDFSIPAELTRLRAWIEAVQARPAVRAIQNPVEFYVERFAKFVKPAATTAA
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcacgccatcaaggagaacaggatgacgaagctgcgactctacagcgcgaaggcg
tgccccttcgcccaccgcacccggctcgttttgcaggagaaggcgatcgacttcgagctg
accgaggtcgatctgcagaacaagccgcgggcgttcgtcgacgcctcgctctatggaaag
gtcccggcgatcgagcacgagggccaccgcatctgggagtcggcgatcatcaacgagtac
ctcgaggaggtcttccccgagccccggctcctgcccagggagccgggcaggcgcgcgctg
gcgaggatctggatcgattacgcgaacacgcgcctcgtgccggcgttcacccagctgctc
agggccgagacgcgagaccaggaggcggcggggcgcaaggcgctcggcgacgtgctcgcg
ttcatcgagcgggaggcgctggcgaggtcgtcgggccaggggccctactggctcggcgcc
gaggtcagcctcgtcgatgtctccttctatccatggttcgagcggctgccggccgtcggc
cgcctccgcgacttctccatccccgcggagctcacgcggctccgggcgtggatcgaggcc
gtgcaggcgcgccccgcggtccgcgccatccagaatccggtcgagttctacgtggagcgc
ttcgcgaagttcgtgaagccggcggcgacgacggccgcctga

DBGET integrated database retrieval system