KEGG   Sorangium cellulosum So ce56: sce0768Help
Entry
sce0768           CDS       T00634                                 

Definition
(GenBank) Putative Glucoamylase precursor (Glucan 14-alpha-glucosidase) (14-alpha-D-glucan glucohydrolase)
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
scl  Sorangium cellulosum So ce56
Pathway
scl00500  Starch and sucrose metabolism
scl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    sce0768
Enzymes [BR:scl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     sce0768
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: CAN90925
UniProt: A9EP11
LinkDB All DBs
Position
complement(1075346..1076716)
Genome map
AA seq 456 aa AA seqDB search
MASSFGYLSTSVDVSSVSFDAISKYMQVLLLRNIATGTWVFSKGAMQSVKGCVLASPSLP
DDRGQTDQDYVHHWIRDAAICIPEALDNPVFMARTLCEDYTMFSALCQENAERANRFALA
CFHIDGTVRDNWTSQTDGPAHRILSLLAIEDRLSLQALATARSIIEKDTRYLLSAYKEQT
HNLWEETAGFSFYARSVQRKAFLSLISRADEHGLSPYINDMWAAAEWLGSQMATHQGTYD
GQPYYASITGPNGRPVEGRGATLNVDVVMSAVYGSTNCADPVLLSTAALVREAFAQGDRR
YRINDADAALPRSRGPMIGRYPEDTYDGNLSDHGPDAGHPWALTTCNFAELYFMLAAKIK
SSPGAVLVNATTQKFFAQVGVNDPADPDIAAKLIDAGDRMLEAVIYHSDRLQLSEQFDRD
NGYECSVSDLSWSYATFRSAVRAREAAVGDFPSRHG
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggccagttcattcggttacctgagcacgagcgtcgacgtctcgtccgtatcgttcgac
gcgatcagcaagtacatgcaagtgctcctcctgcggaacatcgcgacggggacctgggtc
ttcagcaagggcgcgatgcagtccgtcaaggggtgtgtgctcgcgtccccgtccctgccg
gacgacaggggtcagaccgaccaggactatgtgcaccactggatccgggacgcggccatc
tgcattccggaggcgctcgacaacccggtcttcatggcgcggaccctctgcgaggattac
acgatgttctcggcgctgtgccaggagaacgccgagcgagcgaacaggttcgcgctggcg
tgcttccacatcgacggcaccgtgcgcgacaactggacctcccagacggatggcccggcg
caccgcattctgtccctgctcgccatcgaggatcggctctcgctgcaggcgctcgccacg
gccaggtcgatcatcgagaaggacacccggtacctcctctcggcctacaaggagcagacg
cacaacctctgggaggagacggccgggttcagcttctatgcgcgctccgtgcagcgaaag
gcgttcctctcgctgatcagccgcgccgacgagcacgggctctctccgtacatcaacgac
atgtgggcggccgcagagtggctgggcagccagatggcgacgcaccagggcacgtacgac
gggcagccgtactacgcgtccatcacggggccgaacggcaggcctgtcgaaggcagggga
gcgacgctcaacgtggatgtcgtcatgtcggccgtctacggctccacgaactgcgcggac
ccggtgctgctctcgacggccgcgctggtgcgcgaggcgttcgcccagggcgaccgccgg
taccgcatcaatgacgccgatgcggcgctgcctcggagcagggggccgatgatcgggcgg
taccccgaggacacgtacgacggcaacctgtcggatcacggtcctgacgccggtcacccg
tgggcgctcacgacgtgcaacttcgcggagctctacttcatgctcgcggcgaagatcaag
agctcccccggcgccgtgctcgtgaacgccacgacgcagaagttcttcgcgcaggtgggc
gtgaacgatcccgccgatccggacatcgcggcgaagctgatcgacgcgggcgacaggatg
ctcgaggcggtgatctaccactccgatcgcctccagctgagcgagcagttcgatcgcgac
aacgggtacgaatgcagcgtgagcgatctgagctggagttacgccaccttccggagcgcg
gtcagggcgcgcgaggccgccgtgggggattttccgagccgccacgggtag

DBGET integrated database retrieval system