KEGG   Sorangium cellulosum So ce56: sce3427Help
Entry
sce3427           CDS       T00634                                 

Gene name
ppc
Definition
(GenBank) Family membership
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
scl  Sorangium cellulosum So ce56
Pathway
scl00620  Pyruvate metabolism
scl00680  Methane metabolism
scl01100  Metabolic pathways
scl01120  Microbial metabolism in diverse environments
scl01200  Carbon metabolism
Module
scl_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:scl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    sce3427 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    sce3427 (ppc)
Enzymes [BR:scl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     sce3427 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: CAN93586
UniProt: A9GNI8
LinkDB All DBs
Position
complement(4781764..4784505)
Genome map
AA seq 913 aa AA seqDB search
MPPRRREVDRPLRKEVRLLGRLLGEVLIEQEGEELFAIEERIRTLAIRRRRGPSDGRAHA
AAELSKLLAELPHDRLEPVIRAFTVYFRLVNLAEQHHRIRRARAYATDPGARPQRGSIEA
AMHTLKKAGVPAERVRAALRTLDVTLTLTAHPTEAARRTVLEKLYRIAKNLEERDRCQLT
PDESARKLAEIREEITALWQTDEVRRDRPTVGDEVKNVAWYIEEILWDLLPDLPTVIGRA
FEAAYGEPLDAEIAPLRIHSWVGADMDGNPLVVPAVLEDALFAYRIRGLRRLVRAVRDLG
GALSQSVRHVTPPPWLLASIEEDAAAMPEVAAHFGPRTEGEPWRRKLHFIEARLTATLEH
AEHGRAEARARSGQGPAREGRAFVRPEEPTLAVPYREPAELERDLAVVADSLRAARCASS
GERRARALLSQVRALGFALAELEMRAPAEDARAAAASLAEGRVEPAQMTPEARRVFEALQ
RIAAAQRDGGESSCRTLVLSMTHSEDDVLAALASAKAAGLWDEARSCARIDVVPLFESLA
ALNDSARILRALLAHPEYRPHVLARGVQEVMIGYSDSGKEVGLLAASAALRRVQETLPKI
AAEAELPLRVFHGRGESVARGGGPAHQALLALPAGSVGGRYKATEQGEALDHKYARPELA
MRTLEIMLSGVLLHTLGAQPRPPAASELRYAAAFDELAETGRRAYRALVWEEPKFVEFFT
AVTPIDEIARLPLGSRPSKRRAGGLESLRAIPWVFAWTQNRAILPGWYGVGSGLEAMGQR
PEGAELLKEMMASWPFFRAVIDNVEMVLAKADMTIFAGYAELAPAAARKAVAPRIIAEYK
RTRSWLKRLTGNRRLLEGNPTLQRSISLRNPYVDPLSFLQVELLRASRGGDSGRDRSLLL
TLNGIAAGMRNTG
NT seq 2742 nt NT seq  +upstreamnt  +downstreamnt
atgccgccgcgtcgccgcgaggtcgatcgacctcttcgcaaagaagttcgcctgctcgga
cgcctgctcggagaagtgttgatcgagcaggagggagaagagctcttcgccatcgaggag
cgcatccgcacgctcgccatccgccggcggcgcggccccagcgacggccgcgcgcacgcg
gccgcggagctcagcaagctgctcgcggagctgccccacgatcgcctcgagcccgtcatc
cgcgcgttcaccgtctacttccggctcgtcaacctcgcggagcagcaccaccgcatccgc
cgggcgcgcgcgtacgcgacggatcccggcgcgcggccgcagcgcgggtcgatcgaggcc
gcgatgcacacgctcaagaaggccggcgtgccggcggagcgcgtgcgcgccgcgctcagg
acgctcgacgtgacgctcaccctcaccgcgcacccgacggaggccgcgcggcgcacggtg
ctcgagaagctctaccgcatcgcgaagaacctcgaggagcgcgatcgctgccagctgacg
cccgacgagtcggcgcgcaagctcgccgagatccgcgaggagatcaccgcgctctggcag
accgacgaggtgcgccgcgatcgccccaccgtcggcgacgaggtgaagaacgtcgcctgg
tacatcgaggagatcctctgggatctgctccccgatctgcccaccgtgatcgggcgcgcg
ttcgaggccgcctacggcgagccgctcgacgcggagatcgcgccgctccggatccactcg
tgggtcggcgccgacatggacggcaacccgctcgtcgtgcccgccgtgctcgaggacgcg
ctgttcgcctaccgcatccgcgggctgcgccggctcgtccgggcggtgcgcgacctcggc
ggcgcgctgtcgcagtcggtccggcacgtcacgccgccgccctggctgctcgcctcgatc
gaggaggacgccgccgcgatgcccgaggtggccgcgcacttcggcccgcgcaccgagggc
gagccgtggcgccgcaagctgcacttcatcgaggcgcgcctcaccgcgacgctcgagcac
gcggagcacggccgcgcggaggcgcgcgcgcgctccgggcagggccccgcgcgcgagggg
cgcgccttcgtgcgcccggaggagccgacgctcgccgtcccctaccgcgagcccgcggag
ctcgagcgcgacctcgcggtcgtcgccgacagcctgcgcgccgcgcgctgcgcgagctcg
ggcgagcggcgcgcgcgggcgctgctctcgcaggtgcgcgcgctcgggttcgcgctcgcg
gagctcgagatgcgcgcgccggccgaggacgcgcgcgccgcggcggccagcctcgcggag
ggccgcgtcgagccggcgcagatgacgcccgaggcgcgccgcgtgttcgaggcgctccag
cgcatcgccgcggcgcagcgcgacggcggcgagtcgtcctgccgcacgctcgtgctgtcg
atgacccacagcgaggacgacgtcctcgccgcgctcgcgagcgcgaaggccgccgggctg
tgggacgaggcgcgctcgtgcgcgcggatcgacgtcgtgccgctgttcgagtcgctcgcc
gcgctgaacgacagcgcgaggatcctgcgcgcgctgctcgcgcaccccgagtaccggccg
cacgtcctcgcccgcggcgtgcaggaggtgatgatcggctacagcgactccggcaaggag
gtcggcctgctcgcggcgagcgccgcgctccggcgcgtgcaggagacgctgccgaagatc
gccgcggaggcggagctgccgctccgcgtcttccacggccgcggcgagtcggtggcgcgc
ggcggcggaccggcgcaccaggcgctgctcgccctgccggccggcagcgtcggcggccgc
tacaaggcgaccgagcagggagaggcgctcgaccacaagtacgcgcgccccgagctcgcg
atgcgcacgctcgagatcatgctgagcggcgtgctcctgcacacgctgggcgcgcagccg
cggccgcccgccgcgtccgagctgcgctacgccgcggcgttcgacgagctcgccgagacg
ggccggcgcgcctaccgcgcgctcgtctgggaggagcccaagttcgtggagttcttcacg
gccgtgaccccgatcgacgagatcgcgcgcctgccgctcggctcgcgcccgagcaagcgc
cgcgcgggcggcctcgagtcgctgcgcgcgatcccgtgggtcttcgcgtggacgcagaac
cgggccatcctcccggggtggtacggcgtcggcagcggcctggaggcgatgggccagcgc
cccgagggcgcggagctgctgaaggagatgatggcgtcgtggccgttcttccgggcggtc
atcgacaacgtcgagatggtgctcgcgaaggcggacatgacgatcttcgcgggctacgcg
gagctcgcgccggccgccgcgcgcaaggcggtcgcgccgcggatcatcgcggaatacaag
cggacgcggtcgtggctcaagcggctcacgggcaaccggcggctgctcgagggcaacccg
acgctccagcggtccatctcgctgcgcaatccttacgtcgaccccctttcattcctgcaa
gtcgagctcctgcgggcgagccgcggcggggactcggggcgcgatcgctcgctcctgctc
acgctgaacggcatcgccgccggcatgcgcaacacggggtga

DBGET integrated database retrieval system