KEGG   Sorangium cellulosum So ce56: sce3979Help
Entry
sce3979           CDS       T00634                                 

Definition
(GenBank) unnamed protein product; Family membership
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
scl  Sorangium cellulosum So ce56
Brite
KEGG Orthology (KO) [BR:scl00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:scl01002]
    sce3979
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:scl04147]
    sce3979
   04090 CD Molecules [BR:scl04090]
    sce3979
Enzymes [BR:scl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     sce3979
Peptidases [BR:scl01002]
 Metallo Peptidases
  Family M2
   sce3979
Exosome [BR:scl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   sce3979
CD molecules [BR:scl04090]
 Proteins
  sce3979
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-ProteinID: CAN94139
UniProt: A9EQH0
LinkDB All DBs
Position
complement(5538611..5540443)
Genome map
AA seq 610 aa AA seqDB search
MVRIPMFVVALPCGMLALTAACSDPAPPTPPQPATDPAAEEAARFIDAAEAELHELSTYN
NRAAWVAATYITVDTEILAAAASAKLLGVQADYAKRAARFLDLDLPYDVRRRLELLRTSL
TLYAPADPAKTKEVATIASRLEAMYGAGKYCPASGECLTLEDLSRTLAKSCDPEELKRAW
VGWHTVSAPMRGDFTRLVQLANEGARELGFKDTGDAWRSKFEMRPGVLSREVDRLWGQVK
PLYDALHCYARGRLAAKYGEDVAPGKGPIRADLLGNMWAQDWSNIYDLMEPEGAAPIYDL
DAALQAKGYTPIEMVKTGERFFVSLGFEPLPATFWERSLFVKPADRDVVCHASAWNIDDE
EDLRIKMCIEITAGDFQTIHHELGHTFYQRAYNQLPLLYRDSPNPAFHEAIGDTIGLSVS
PEYLQRIGLVDQLPPASSDLSLLLREALGKIAFLPFAVSVDRWRWGVFSGDIQPAAYNKA
YWEIRRRYQGVVPPVPRSESDFDPGAKYHVAASVPYIRYFFAHILQFQFHRALCDAAGYK
GPLHRCTIYGSDKAGERLRRMLEMGRSRPWPEALEVVTGSRRMDAAALLDYFGPLKDWLD
QQNRGKTCGW
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atggttcgcattccgatgttcgtcgtcgcgttgccctgcggcatgctcgcgctcacggcg
gcctgctccgatcccgcaccgcccacgccgccgcagcccgccaccgacccggcggcggag
gaggccgcgcggttcatcgacgcggccgaggcggagctgcacgagctcagcacctacaac
aaccgcgcggcgtgggtggcggcgacgtacatcaccgtcgacaccgagatcctcgcggcc
gcggcgagcgcgaagctgctcggggtccaggccgattacgcgaagcgggccgcccgcttc
ctcgacctcgatctgccctacgacgtccgccgccggctcgagctcctgcgaacgtccctc
acgctctacgcacccgccgatcccgcgaagacgaaggaggtcgcgaccatcgcgtcgagg
ctggaggccatgtacggagcgggcaagtactgccccgcgagcggcgagtgcctcactctc
gaggacctgagcaggaccctcgcgaagagctgcgaccccgaggagctgaagcgggcgtgg
gtcggctggcacacggtctctgcccccatgcggggcgatttcacgcggctcgtccagctg
gcgaacgagggcgcccgcgagctcgggttcaaggacacaggcgacgcgtggcgctcgaaa
ttcgagatgcggcccggcgtgctgtcgcgggaggtcgatcgcctctgggggcaggtcaag
ccgctctacgacgcgctccactgctacgcgcggggccggctcgccgcgaagtacggcgag
gacgtcgcgcccggcaagggcccgatccgggcggatctgctcggcaacatgtgggcgcag
gactggagcaacatctacgatctcatggagcccgagggcgccgcgccgatctacgatctc
gacgccgcgctgcaggcgaaggggtacacgccgatcgagatggtgaagacgggcgagcgc
ttcttcgtctcgctcgggttcgagccgctcccggccaccttctgggagcggtcgctcttc
gtcaagccggcggatcgcgacgtcgtctgccacgcgagcgcgtggaacatcgacgacgag
gaggatctgcgcatcaagatgtgcatcgagatcacggccggcgacttccagacgatccac
cacgagctcggccacaccttctaccagcgggcgtacaaccagctgccgctcctgtaccgc
gacagccccaaccccgcgtttcacgaggccatcggcgacacgatcgggctctcggtcagt
ccggagtacctccagcggatcgggctcgtggaccagctgccccctgcctccagcgatctc
tcgctcctcctccgcgaggccctcgggaagatcgccttcctgccgttcgccgtctcggtc
gaccggtggcgctggggggtgttctcgggggacatccagccggcggcatacaacaaggcc
tattgggagatccggaggaggtaccagggcgtcgtgccgccggtgcctcgctccgagtcg
gacttcgatcctggcgcgaagtaccatgtggcggcgagcgtcccgtatatccggtacttc
ttcgcccatatcctccagttccagttccaccgcgcgctctgcgatgcagcggggtacaag
gggccgctccaccgctgcacgatctacggcagcgacaaggccggcgagcgtctccggcgg
atgctggagatggggcggagccgcccgtggccggaggcgctcgaggtggtgacgggatcg
cggcggatggatgcggcggcgctgctcgactacttcgggccgctcaaggactggctcgac
cagcagaaccgcggcaagacgtgcgggtggtag

DBGET integrated database retrieval system