KEGG   Sorangium cellulosum So ce56: sce4102Help
Entry
sce4102           CDS       T00634                                 

Gene name
cga2
Definition
(GenBank) Glucan 1,4-alpha-glucosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
scl  Sorangium cellulosum So ce56
Pathway
scl00500  Starch and sucrose metabolism
scl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    sce4102 (cga2)
Enzymes [BR:scl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     sce4102 (cga2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: CAN94265
UniProt: A9EVX1
LinkDB All DBs
Position
complement(5723943..5726321)
Genome map
AA seq 792 aa AA seqDB search
MDRALHTSRPTRCALLAGRSRSMRNLGRTLLVAALGGPLPLAGVASAATPTGAAPGSSSA
GSWSQGSKDLFGAAYESYDEDLKYSARSDTAPISNVWFTGASGILTEVFWPTNDTAQTRD
SQLLVTAAGRGLFEERRDARQSVRWIERGVPAFRVITEDPGGRFRIEKIVFADPDRDVVL
QRLKITRKVRGLRFFVLHNPSVGNTPLGDSAMASTGGAPGAGLFAWQGPFAQALVASVRW
RDATAGFSGAESDGYRDLQNHRTLTTHYRDARDGDVVLTGELDLPLSPGVCELTLALGFG
RDIDEAHRAAQASLREDPGALLDRYRAQWRAYQASLRPLGSASPDLARLYRSSVAVMKSL
EDRAHPGAFIASPSVPWGDVRLDRASALSPRTSGRITGGYHLVWPRDLSQIALALLAAGD
TRSPVAAMRFTKRIQLSASDGTWDFGPLHVSKDGSFYQNTWSDGEPYWRGLELDQVAQPI
DLCYHVVEERLVAADACWDLARRAADFLVAFGPWTPLDRWEEVSGVSPSTLAFVCAALAH
AAEIAGAMGDPAREARYRETAERWARQVDGWTFTTQGGTANGRYFVRVDGTGSPDAPRDP
NDERRYVLRGRSWLERDIVDCGFLRLVVLGVRPALAANIADSLAACDAALRVEVPGVGPG
FYRYVGDGYGFDPRTGERTRGMVWPLLTGERAEYELANALAKSSSPAAARKRMRPYLDAM
GRFATASQMLPEQVFDRGSRAGQPTGAAAPLGWAHAEFVLALREHDDAMLFRLPMSRAGG
ATRRDARGSSAP
NT seq 2379 nt NT seq  +upstreamnt  +downstreamnt
atggaccgggcgttgcacacttccagaccgacgcgctgcgcgctcctcgctggtcggagc
cggtccatgcgaaatctcggaagaacgctgctggtcgcggcccttggcggcccgctcccg
ctcgccggcgtggccagcgccgcgacgcccaccggcgcggcgcctggatcctcgtccgcg
gggagctggtctcaaggctccaaggatctcttcggcgccgcatacgagagctacgacgag
gatctgaagtactcggcgcgctccgacacggccccgatcagcaacgtatggttcaccgga
gcgagcggcatcctgaccgaggtgttctggccgacgaacgataccgcgcagacgcgggac
agccagctgctcgtcacggcggccggcagaggcctcttcgaggagcggcgagacgcgcgg
cagagcgtccgctggatcgagcgcggcgtgccggctttccgggtgatcacggaagatccg
ggcggcaggttcagaatcgagaagatcgtcttcgccgatcccgatcgcgacgtggtcctg
cagcggctgaagatcacccggaaagtccgagggctcaggttcttcgtccttcacaacccc
agcgtggggaacacgccgctcggtgacagcgcgatggcgagcacgggaggcgcgccgggg
gcagggctcttcgcctggcaaggccccttcgcccaggccctcgtggcttccgtccgctgg
cgcgacgccacagccggcttctcgggcgccgagagcgacggctatcgggacctgcagaac
caccgcacgctgaccacccactaccgcgacgcgagggacggggacgtcgtgctgaccggg
gagctggatctcccgctctcgcccggggtctgtgagctcacgctggcgctcggcttcgga
cgcgacatcgacgaggcccaccgcgccgcccaggcgtcgctccgcgaggatcccggcgcg
ctcctcgacaggtaccgcgcccagtggcgcgcctatcaggcgtccctccgcccgctcggg
agcgcttcgcccgacctcgcgcgcctctaccggagctccgtggccgtgatgaagtccctc
gaggacagggcgcaccctggggccttcatcgcgtcgccgtccgtgccctggggcgacgtc
aggctcgaccgggcgagcgcgctctcgccgaggacctcgggcaggatcacgggcggttac
cacctcgtgtggccgcgcgatctcagccagatcgcgctcgcgctgctcgccgcgggcgac
acgcgctcgcccgtggccgcgatgcggttcacgaaacggatccagctctccgcgtcggac
ggcacctgggatttcggccctctccatgtctcgaaggacggttcattttaccagaacacc
tggtccgacggagagccgtactggaggggcctggagctcgatcaggtcgcgcagccgatc
gacctctgttatcacgtggtcgaggagcggctcgtcgcggcggatgcgtgctgggatctc
gcgcgccgcgccgccgacttcctcgtcgccttcggcccctggaccccgctcgatcgatgg
gaggaggtctcgggcgtctcgccgtcgaccctggccttcgtctgcgccgcgctcgcccat
gccgcggagatcgcgggcgcgatgggtgaccccgcgcgcgaggcccggtacagagagacg
gccgagcgctgggcccggcaggtcgacggctggacgttcaccacccaggggggcaccgcc
aacgggcggtatttcgtgcgcgtcgacgggaccggcagcccggacgccccgagggacccg
aacgacgagcgacgctatgtcttgcgtggccgctcctggctggagcgcgacatcgtcgat
tgcggcttcctcaggctcgtcgtcctcggggtgcgcccggcgctcgcggcgaacatcgcc
gattcgctggcggcctgcgacgccgcgctgcgcgtcgaggtccctggggtcggccccggg
ttctatcgctatgtcggcgacgggtatggcttcgacccgcgcacgggcgagcggacgaga
gggatggtgtggccgctgctcacaggcgagagagccgagtacgagctcgcgaacgcgctc
gcgaagtccagctcgccggcggcggcgcgcaagaggatgcgcccctacctcgacgcgatg
gggcgcttcgcgaccgcgtcccagatgttgccggagcaggtcttcgatcgcgggtcccgc
gccggccagccgaccggcgcggctgcgcccctcgggtgggcgcacgcggagttcgtcctg
gccctgcgcgagcacgacgacgcgatgctcttccgcctgccgatgagccgcgccggaggc
gccacccgacgggacgcgcgcggctcctccgctccgtga

DBGET integrated database retrieval system