KEGG   Sorangium cellulosum So ce56: sce4338Help
Entry
sce4338           CDS       T00634                                 

Definition
(GenBank) Protein kinase
  KO
K08884  serine/threonine protein kinase, bacterial [EC:2.7.11.1]
Organism
scl  Sorangium cellulosum So ce56
Brite
KEGG Orthology (KO) [BR:scl00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:scl01001]
    sce4338
Enzymes [BR:scl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     sce4338
Protein kinases [BR:scl01001]
 Serine/threonine kinases: Other
  Bacterial family
   sce4338
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Seadorna_VP7 Pkinase_fungal Kinase-like Haspin_kinase PIP49_C
Motif
Other DBs
NCBI-ProteinID: CAN94501
UniProt: A9F2M6
LinkDB All DBs
Position
6123063..6124331
Genome map
AA seq 422 aa AA seqDB search
MDQIGEYLVRRLVGEGGMGKVYEGEERLSRRRVALKVLRPELARSEQGRRLFLNEMQILA
HLEHPNIVRSLASIEASGELVMVLEYLDGQTLRSVLGAAGRLPWPEAVRIAASVASALAA
AHGQQPPVIHRDLKPENIMVQRDGGVKVMDFGIAKVVEAMNQTNTQSVGTLQYMSPEQID
ARSIDHRSDLYCLGLILYEALSGSPPFQSASPRELLNLQCTAEPPPLSDDVRSGLPRGVE
QLLFQLLEKAPEDRPYLAQDIVDRLEPFQTAVSTPLRTGDRDRASAPLRAVAHDRESAPL
RAGDRDRASSPQRTGNRDRASSPQRAGDRDRASVPHRADDPDRASSPGAARVTGGADAPR
ADTIALVEQIDRPRDVPTRLAIAIIATLSALAGLGTCALRSTNGAPEPPASTATPAAPEG
AR
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggatcagatcggcgagtacctcgttcgacgactcgtcggcgagggcgggatgggcaag
gtctacgagggcgaggagcgcctgtcgcgccggcgcgtcgcgctgaaggtgctccgcccc
gagctcgcccggagcgagcagggacgccggctcttcctgaacgagatgcagatcctcgcg
cacctcgagcacccgaacatcgtccggagcctcgccagcatcgaggcctccggcgagctc
gtgatggtgctcgagtacctggacggccagacgctgcggtccgtccttggcgccgccggc
cgccttccctggccggaagcggtgcggatcgcggccagcgtggcgagcgccctcgcggcg
gcccacgggcagcagccgcccgtgatccaccgcgatctcaagcccgagaacatcatggtg
cagcgggatggcggcgtgaaggtgatggacttcggcatcgccaaggtcgtggaggcgatg
aaccagaccaacacgcagagcgtcggcaccctgcagtacatgagcccggagcagatcgac
gcgcgatccatcgatcaccgctcggatctctactgcctggggctcatcctgtacgaggcg
ctctccggcagcccgccgttccagtcggcgtcgccgcgggagctgctcaacctgcaatgc
acggcagaaccgccgccgctcagcgacgacgtgcggagcggcctgccccgcggcgtcgag
cagctgctcttccagctgctcgagaaggcgcccgaggatcggccctacctcgctcaggac
atcgtggatcggctggagccgttccagaccgcggtgagcacgccgctccgcaccggcgat
cgcgaccgcgcgagcgcgccgctccgcgccgtcgctcacgaccgcgagagcgcgccgctc
cgcgctggcgaccgagaccgcgcgagctcgccgcagcgcaccggtaaccgagaccgcgcg
agctcgccgcagcgcgccggcgatcgcgaccgcgcgagcgtgccgcaccgcgccgacgac
cccgaccgcgcgagctcgccgggcgccgcgcgcgtcaccggcggagcggacgcgcctcgc
gccgacacgatcgccctcgtcgagcagatcgaccggccgcgcgacgtcccgacccggctc
gcgatcgcgatcatcgcgacgctgtcggcgctcgcgggcctcgggacctgcgcgctgcgc
tcgacgaacggcgcgccggagccgcccgccagcacggcgacgccggccgccccggagggg
gcgcggtga

DBGET integrated database retrieval system