KEGG   Sorangium cellulosum So ce56: sce4456Help
Entry
sce4456           CDS       T00634                                 

Gene name
mutT
Definition
(GenBank) putative mutT/nudix family protein
Organism
scl  Sorangium cellulosum So ce56
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX NUDIX_4 NUDIX_2
Motif
Other DBs
NCBI-ProteinID: CAN94619
UniProt: A9F3V9
LinkDB All DBs
Position
6287133..6287648
Genome map
AA seq 171 aa AA seqDB search
MLSPHVTKILMEIAPLSLLPRSVLALAKEVARALLRRPVVGIAAAAQTADGRWLLVRRSD
TGTWALPGGTLEWGETLRDSIVRELAEEAGVTEVELGRVVGVYSRPDRDIRFHAVTVVVT
ARIAAPTRPPQNPLEIREARLFREDELPSELAMDMGDLFAAARRAGDTELE
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgctttccccgcacgtcacaaaaattctcatggaaatcgctcccctgtcgctgttgccg
cgctccgtgctcgccctcgccaaggaggtcgcgcgcgcgctgctccggcgacctgtcgtc
ggcatcgccgccgccgctcagaccgccgacggccggtggctgctcgttcgccgcagcgac
accggaacctgggcgctcccgggaggcaccctggaatggggggagacgctccgcgacagc
atcgtgcgggagctcgccgaggaggccggcgtcaccgaggtcgagctcgggcgggtcgtg
ggcgtgtactcgcggcccgatcgcgacatccggttccacgccgtgacggtcgtcgtcacc
gcccggatcgccgcgccgacgcgccccccgcagaacccgctcgagatccgcgaggccagg
ctgttccgggaagacgagctcccgtccgagctcgcgatggacatgggggatctcttcgcc
gccgcccggcgcgccggcgacacggagctcgagtga

DBGET integrated database retrieval system