KEGG   Sorangium cellulosum So ce56: sce6585Help
Entry
sce6585           CDS       T00634                                 

Definition
(GenBank) hypothetical protein
Organism
scl  Sorangium cellulosum So ce56
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PMT_2 PsaN
Motif
Other DBs
NCBI-ProteinID: CAN96754
UniProt: A9GPG7
LinkDB All DBs
Position
complement(9158449..9160257)
Genome map
AA seq 602 aa AA seqDB search
MRDAAPDATAAPAPLAPSSESARERLAAGPPRVVGARAIRAASLGVIAFLLLQVLTYGYG
RDQGIYAMVARAVLDGGMPYRDAFDFKPPGIFLIYALARALFGPAQWGIRVLEVLGLAGM
CLAMASLAARLFGDRRIGVVAAALAVLVHAQLDFWHTAQPESFGGMLTIAALLVATPRGR
DGAPRPAPRGAALVLSGALFGAAGLLKPPLAGGGVVLAVALAAPALAELARRGAARAAVQ
RWIDAGPTALQGEPARPAPPAPGPVRSTAAALLWAALRPALLIALGGVLPVLACAAWFAL
RGALGDLREVLFVFTPHYTALGWRGASVLGMAWYGASEWLVHYSGPLAFGLACLVALHPE
RHERAGVALLSGVIAMHLVGVVMQAKFFPYHYGATWPLTAMLAALGLWKAWQRCTRSGAK
AAAAALLAALVATAFARSATKDVADDYIERCAKRIAVLATGARDQARLDRLASVADVNAA
ANREVAMWLRERVAPGRPVFVWGFEPVIYDLADRPPATRYLYNVPQRAAWARQEARDALM
RDLAASPPAAIVVERHDVFPSVTGDVIDSRDTLNGFPELAGLIEERYELAVSIEDFEIHL
ER
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtgacgccgcgccggatgcgaccgcagcccccgcccccctggccccctcgagcgag
agcgcgcgcgagcgcctcgccgccgggccgccgcgcgtcgtgggggcgcgggcgatccgg
gcggcctcgctcggcgtcatcgcgttcctgctgctgcaggtgctgacctacggctacggc
cgcgatcagggcatctacgccatggtcgcgcgcgcggtgctcgacggcggcatgccttac
cgcgacgcgttcgacttcaagccgcccggcatcttcctcatctacgcgctcgcccgcgcc
ctcttcggccccgcgcagtggggcattcgcgtcctcgaggtcctcggcctcgccggcatg
tgcctcgcgatggcgtcgctcgccgcccgcctcttcggcgaccggcggatcggcgtcgtc
gccgcggcgctcgccgtgctggtgcacgcccagctcgatttctggcacacggcgcagccc
gagtcgttcggcggcatgctcaccatcgccgcgctgctcgtggccacgccgcgcggccgc
gacggcgcgccccgcccggcgccgcgcggcgccgcgctggtcctgtcgggcgcgctcttc
ggcgccgccggcctcctcaagccgcccctcgccgggggcggcgtcgtgctcgccgtcgcg
ctggccgcgcccgccctcgccgagctcgcgcggcgcggcgcggcgcgggccgccgtccag
cgctggatcgacgccggtccgaccgcgctccagggcgagccggcgcgccctgcgccgcct
gcgcccgggccggtccgatcgacggcggccgcgctcctctgggcggcgctccggcccgcc
ttgctcatcgcgctgggcggcgtgctccccgtgctcgcctgcgccgcctggttcgccctg
aggggcgcgctcggcgatctgcgggaggtcctcttcgtcttcacgccgcactacaccgcg
ctcggctggcgcggcgcgagcgtgctcggcatggcgtggtacggcgccagcgagtggctc
gtccactactccggcccgctcgcgttcggcctcgcttgcctggtcgcgctgcaccccgaa
cgccacgagcgggcgggcgtggcgctgctctcgggcgtgatcgccatgcacctcgtcggc
gtcgtgatgcaggcgaagttcttcccctaccactacggcgcgacgtggccgctcaccgcg
atgctcgccgcgctcggcctctggaaggcgtggcagcggtgcacccggtccggcgcgaag
gcggccgcggcggcgctcctcgcggcgctcgtcgcgaccgccttcgcccgctccgcgacc
aaggacgtggccgacgactacatcgagcgctgcgccaagcggatcgcggtgctcgccacc
ggcgcgagggaccaggcgcgcctcgatcgcctcgcgtcggtcgccgacgtcaacgccgcg
gcgaaccgggaggtcgccatgtggctgcgcgagcgcgtcgcgccggggcgccccgtgttc
gtgtggggcttcgagccggtgatctacgatctcgccgatcgcccgccggcgacgcgctac
ctctacaacgtcccgcagcgcgcggcgtgggcccggcaggaggcgcgcgacgcgctgatg
cgcgacctcgccgcgagcccgccggccgcgatcgtggtcgagcgccacgacgtcttcccc
tcggtgaccggcgacgtgatcgactcgcgcgacaccctgaacgggttccctgagctcgcg
gggctcatcgaggagcgctacgagctcgccgtgagcatcgaggatttcgagatccacctc
gagcgctga

DBGET integrated database retrieval system