KEGG   Sorangium cellulosum So ce56: sce6960Help
Entry
sce6960           CDS       T00634                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
scl  Sorangium cellulosum So ce56
Brite
KEGG Orthology (KO) [BR:scl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    sce6960
Enzymes [BR:scl01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     sce6960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA DAO FAD_binding_2 HI0933_like FAD_oxidored Glutaredoxin K_oxygenase NAD_binding_8 Thi4 FAD_binding_3 AlaDh_PNT_C NAD_binding_9 FMO-like
Motif
Other DBs
NCBI-ProteinID: CAN97129
UniProt: A9GXQ7
LinkDB All DBs
Position
9706873..9708435
Genome map
AA seq 520 aa AA seqDB search
MLEDSIKTQLRDVLGRLTRPVAVTAFVDDSQGSEEMRALLRDVASASSLVELHERREGAE
RTPSFGIHSPGEEPRVIFAGLPLGHELTSLILALLHVGGHPPRVSAEALEQIARIDGELR
FETYFSQSCQNCPDVVQALNLMAAKNPRVRHVAVDGALFQGEVEQRKIMAVPTVFLNGEP
FGQGRMEIEQILAKLDDGSAVKKRAEALDQRKPFDMLIVGGGPAGASAAIYAARKGLDTG
IVAERFGGQVMDTLAIENLISVVETDGPKLAAALEQHVRAYPVELLKHERVTSITPGSPF
ELRLASGATLRAKSVVLATGARWRDMNVPGEAEYRTKGVTYCPHCDGPLFKGKRVAVIGG
GNSGVEAAIDLAGVVGHVTLLELAPALRADAVLVRKLKSMPNVEIVTRARTTEVVGDGQK
VVGLRWEHTETKEQHQIEIAGVFVQIGLLPNTGFIKGTVELNGLGEVVVNDRGQTSVPGL
FAAGDMTTTPFKQIVVALGDGAKAALGAFEYLIRATAPAE
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgctcgaagactccatcaagacccagctccgcgacgtcctcggacggctgacccgtccc
gtcgcggtcaccgccttcgtcgacgactcgcaggggtcggaggagatgcgcgcgctcctg
cgcgacgtcgcgagcgcctcgtccctcgtcgagctccacgagcggcgcgagggcgccgaa
cgcacgccgtcgttcggcatccactcccctggcgaggagccgcgcgtcatcttcgcgggg
ctcccgctcggtcacgagctcacctcgctgatcctcgcgctcctgcacgtcggcggccat
ccgccgcgggtgagcgccgaggcgctcgagcagatcgcgcggatcgacggcgagcttcgg
ttcgagacctacttctctcaatcgtgccagaactgccccgacgtcgtgcaggcgctgaac
ctgatggcggccaagaacccgagggttcgccacgtcgccgtcgatggcgccctcttccag
ggcgaggtcgagcagcggaagatcatggccgtgccgaccgtcttcctgaacggcgagccc
ttcggccagggtcggatggagatcgagcagatcctcgccaagctcgacgacggctccgcc
gtgaagaagcgcgccgaggcgctcgaccagcgcaagccgttcgacatgctcatcgtcggc
ggcgggcccgccggcgcttcggcggccatctacgcggcgcgcaagggcctcgacaccggc
atcgtcgccgagcgcttcggcgggcaggtgatggacaccctcgccatcgagaacctcatc
tcggtcgtggagaccgacgggcccaagctcgcggcggcgctcgagcaacacgtgcgcgcg
taccccgtggagctcctcaagcacgagcgcgtcacgtcgatcacccccggctcaccgttc
gagctgcgcctggcgagcggcgccacgctccgcgcgaagagcgtcgtcctggcgacgggc
gcccggtggcgcgacatgaacgtccccggcgaggccgagtaccggaccaagggcgtgacg
tactgcccgcactgcgacgggccgctgttcaagggcaagcgagtggccgtcatcggcggc
ggcaactccggcgtcgaggcggcgatcgatctcgcgggcgtggtcggccacgtcaccctg
ctcgagctcgcccccgccctccgcgccgacgcggtcctcgttcgcaagctcaagagcatg
cccaacgtcgagatcgtcacgcgcgcgcgcacgaccgaggtggtgggcgacgggcagaag
gtcgtcgggctccgctgggagcacaccgagacgaaggagcagcaccagatcgagatcgcg
ggcgtgttcgtgcagatcggcctgctccccaacaccgggttcatcaaggggacggtggag
ctcaacggcctcggcgaggtcgtcgtcaacgaccgcgggcagacgtcggtgcccggcctc
ttcgccgccggcgacatgacgaccacgccgttcaagcagatcgtcgtcgccctcggcgac
ggcgcgaaggccgccctcggggccttcgagtacctcatccgcgccaccgcgccggcggag
tga

DBGET integrated database retrieval system