KEGG   Sorangium cellulosum So ce56: sce8012Help
Entry
sce8012           CDS       T00634                                 

Definition
(GenBank) AMP-binding enzyme family protein
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
scl  Sorangium cellulosum So ce56
Pathway
scl00061  Fatty acid biosynthesis
scl00071  Fatty acid degradation
scl01100  Metabolic pathways
scl01212  Fatty acid metabolism
scl02024  Quorum sensing
Module
scl_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:scl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    sce8012
   00071 Fatty acid degradation
    sce8012
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    sce8012
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:scl01004]
    sce8012
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:scl04147]
    sce8012
Enzymes [BR:scl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     sce8012
Lipid biosynthesis proteins [BR:scl01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   sce8012
Exosome [BR:scl04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   sce8012
  Exosomal proteins of breast cancer cells
   sce8012
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding NAD_binding_4 Acyltransferase Sterile SCP2 AMP-binding_C AAA_16
Motif
Other DBs
NCBI-ProteinID: CAN98182
UniProt: A9FH48
LinkDB All DBs
Position
11144127..11148719
Genome map
AA seq 1530 aa AA seqDB search
MSHMGVTNGAGAGEAAPGSPGGAKGEETAAAPPLVPSHVLSGKRLVVVGGTGFLGKVWLA
MLLARFPEIAHIYLLVRAKENQSPEERFWSQIVTSPVFDPIREQYPGPAFEEYLRQKITP
MNGNVGLPLLGLGDRVGELTGNIAAVVNVAGVVDFNPPLDEALEVNAFGISNLVELARTL
GAKVMHTSTCFVAGYRSGLIEENHPSEIPFPRAAGETWFGAACPKRTLDRSHWDPQREIS
ECLDLVQQARQRCEDAFRQSAFLDEAKANLAARSEPCRGSALENELARVKRKFIKDRLIE
AGKERALFWGWTNIYTYTKSIGEQVLASSGLPFTIVRPAVVETAVEFPFTGWNEGINTSA
PYLYLASKGQVQFPGDHDVRLDLIPVDMTASGMIASLCELIEGRAPAVYQYGSTDTNGCR
VTRYLELAGLYKRRQVFEGKKTSLFDVVSSRFEPRGLTRQQYGAHGARAIEGALRGLGGL
LKTASVGPAAALLKPAAAALENAARTEQKTATLLEVFMPFVAEGDWVYSCANTRAAMARM
PPEERARFVWAPEKIDWRDYIWNVHLPGLEKWAFPLMEEMLRREIKPLRPYDSLVDLLDE
VAERFDHALSVQRFEQDGLSRTSYRELRDAACMTAARLAALGVRRGDRVALSGANQPAWP
VAYFGILRAGAVAVPIDPGLDAKAFADVLRSSTAKVVLWDGGVAERLGADVRAALPNLHA
FDMVGFAEGQVPDLGPASGDGLAPPDVRVGSQDVASVVYTSGTTGEPKGVLLTHGNFTAL
LASLAPLFPLKASDRVLSVLPLHQTFEVTCGLLLPLSQGARIIYLDEVSADRVSDGLKKA
RVTAMVGVPALWQMLERQIVARVKEQGPAAATAFSWAMELNRMLGKRLGLNAGRLFFGSV
HDALGGNVRFLISGGAALPRDTAAVFKGLGLPLAEGYGLTEAAPLLTVTKPSPAASPGNV
GKPIPGVKIKIANPDANGVGEVLARGPNVMKGYADDPDATQAALDADGWLRTGDLGKLDK
QGRLVLVGRQSEVISAAKGESLYPADIERMLGKIEHVKELAIVGIDNGRGGEQVACLAVP
TAPGAKDGEGDPALARAAQHERALDALRTAIQALPKPCHPMAVHLDDADLPRTASGQVKR
SEVKAIVTRLAAEAAAAGAGAAAVAQDAGAATAEPKAHSAGDEPIHIPRPVADFAKHWMN
KVQSGFYGNVMRPKVYGRAFIPHNRNTIVVSNHASHLDMGLVKFALGSYGDGLVSLAAQD
YFFEGNRWRRAYFENLTNLAPFDRKGGLRTALRQTGEILDRGRTVLLFPEGTRSPDGGIL
EFKPAIGHLALTHNVDILPLYLGGTFEALPKGRTVPIRRDLVARIGPPLAIGDLRRLTAG
MKYAVACRKVAELTQLAVIKLKEGGALDLSRVESIDQAATTAKEHPLTLLFRELESKYVA
GRVAQPITYYVTLGTEDEAKWTLRIDAASCEARIGKPSQQADCVLKTTPEIFTKIVREAY
TPSPMEFMTGLVKSNDISLLQTFQKVFDLA
NT seq 4593 nt NT seq  +upstreamnt  +downstreamnt
atgagccatatgggtgttacgaacggggccggcgccggagaggcagcgccggggtcgccg
ggtggggccaagggcgaggaaaccgcggcggccccgccgctggtgccgtcgcacgtgctc
tcgggcaagcggctcgtggtggtcggagggaccggcttcctcggcaaggtctggctggcc
atgctgctcgcgaggttcccggagatcgcccacatctacctgctcgtccgggccaaggag
aaccagtcgccggaggagcgcttctggtcgcagatcgtgacctcgccggtcttcgacccg
atccgcgagcagtaccccgggcccgccttcgaggagtacctgcggcagaagatcacgccc
atgaacggcaacgtcggcctgccgctgctcgggctgggcgaccgcgtgggtgagctcacg
ggcaacatcgccgcggtcgtgaacgtggccggcgtcgtcgacttcaacccgccgctcgac
gaggcgctcgaggtcaacgcgttcggcatcagcaacctcgtcgagctcgcgcggaccctc
ggggccaaggtgatgcacacgagcacctgcttcgtcgcaggctaccgctccgggctcatc
gaggagaaccacccgtccgagatccccttcccccgcgccgcgggcgagacgtggttcggc
gccgcctgcccgaagcggaccctcgatcggtcgcactgggatccgcagcgcgagatcagc
gagtgcctcgacctcgtgcagcaggcgcgccagcggtgcgaggacgccttccggcagagc
gccttcctcgacgaggccaaggccaacctggccgcgcgcagcgagccgtgccggggcagc
gcgctcgagaacgagctcgccagggtgaagcgcaagttcatcaaggaccggctcatcgag
gccggcaaggagcgcgcgctcttctgggggtggaccaacatctacacctacacgaagagc
atcggcgagcaggtcctcgcgagctccgggctgcccttcaccatcgtccgccccgccgtc
gtcgagaccgccgtcgagttcccgttcaccggctggaacgaggggatcaacacctcggcg
ccgtacctctacctcgcctcgaaggggcaggtgcagttcccgggcgaccacgacgtgcgg
ctcgacctcatcccggtcgacatgaccgcgagcggcatgatcgcctcgctctgcgagctc
atcgagggccgcgcgcccgcggtgtaccagtacggatcgaccgacacgaacggctgccgc
gtgacgcgctacctggagctcgccgggctctacaagcggcggcaggtgttcgaggggaag
aagacctcgctcttcgacgtcgtgtcatcccggttcgagccgcgcgggctgacccggcag
cagtacggcgcgcacggcgcgcgcgccatcgagggcgcgctccgcggcctgggcggcctg
ctcaagacggcgagcgtcggccccgccgcggccctcctcaagccggcggctgccgcgctc
gagaacgccgccaggaccgagcagaagacggccacgctcctcgaggtcttcatgccgttc
gtcgccgagggcgactgggtctactcctgcgccaacacgcgcgcggcgatggcccgcatg
ccccccgaggagcgggcgcgcttcgtctgggcccccgagaagatcgactggcgtgactac
atctggaacgtccacctccccggcctggagaagtgggccttcccgctcatggaggagatg
ctccgccgggagatcaagccgctccggccctacgacagcctggtcgacctgctcgacgag
gtcgccgagcgcttcgatcacgcgctctcggtgcagcggttcgagcaggacgggctctcg
cgcacgagctaccgcgagctccgcgacgcggcctgcatgaccgccgcgcgcctcgccgcg
ctcggcgtccgccgcggcgatcgcgtggcgctctccggcgcgaaccagccggcgtggccc
gtcgcctacttcggcatcctccgcgcaggcgccgtcgccgtcccgatcgatcccgggctc
gacgcgaaggcgttcgcggacgtcctccgctcgtcgacggcgaaggtcgtcctctgggac
ggcggcgtggcggagaggctcggcgccgacgtgcgcgcggcgctgccgaaccttcacgcc
ttcgacatggtcgggttcgccgagggccaggtgcccgacctgggcccggcctccggcgac
gggctcgcgcccccggacgtgcgcgtgggcagccaggacgtcgcgagcgtcgtctacacg
agcggcacgaccggggagccgaagggcgtgctgctgacgcacggcaacttcacggcgctg
ctggcctcgctggcgccgctgttcccgctcaaggcgagcgaccgcgtgctcagcgtgctg
ccgctccaccagaccttcgaggtcacctgcggcctgctcctgccgctgtcgcagggcgcg
cggatcatctacctcgacgaggtctcggccgatcgggtgagcgacgggctgaagaaggcg
cgcgtcacggcgatggtcggcgtgcccgcgctctggcagatgctggagcgccagatcgtc
gccagggtgaaggagcaggggcccgccgcggccaccgcgttcagctgggccatggagctg
aaccgcatgctcggcaagcgcctgggcctgaacgcggggcgcctcttcttcggcagcgtc
cacgacgcgctcggcggcaacgtccgcttcctcatctcgggcggcgcggcgctccccagg
gacacggccgccgtgttcaaggggctcggcctgccgctcgccgagggctacggcctgacc
gaggcggcgccgctcctgaccgtcaccaagccctcgccggcggcgagcccggggaacgtc
ggcaagccgatccccggggtgaagatcaagatcgcgaacccggacgcgaacggcgtcggc
gaggtgctcgcgcgcggccccaacgtcatgaagggctacgccgacgacccggacgcgacc
caggcggccctcgacgcggacgggtggctccgcacgggcgatctcggcaagctcgacaag
caagggcggctcgtcctcgtcggccggcagagcgaggtcatcagcgcggcgaagggcgag
agcctgtacccggccgacatcgagcgaatgctcggcaagatcgagcacgtcaaggagctc
gccatcgtcgggatcgacaacggccgcggcggcgagcaggtcgcctgcctcgccgtcccc
accgcgccgggcgcgaaggacggcgagggcgacccggcgctcgcgcgggccgcgcagcac
gagcgcgcgctcgacgcgctccggacggcgatccaggcgctgcccaagccgtgccacccc
atggccgtccacctcgacgacgccgacctgccccgcaccgcgtccggccaggtgaagcgc
tccgaggtgaaggcgatcgtcacgcgcctcgccgccgaggccgccgcggccggcgcgggc
gcggcggccgtcgcgcaggacgccggcgcggcgaccgcggagccgaaggcgcacagcgcg
ggcgacgagccgatccacatcccccgcccggtggccgacttcgccaagcactggatgaac
aaggtccagtccggcttctacgggaacgtcatgcgcccgaaggtctacgggcgcgcgttc
atcccgcacaaccgcaacacgatcgtcgtctcgaaccacgcgagccacctcgacatgggc
ctcgtgaagttcgcgctgggcagctacggggacggcctcgtctcgctggccgcgcaggac
tacttcttcgagggcaaccgctggcggcgcgcctacttcgagaacctcacgaacctcgcg
cccttcgaccgcaagggcggcctccgcacggcgctgcgccagaccggcgagatcctggac
cgcgggcggacggtgctcctcttcccggagggcacgcgcagccccgacggcggcatcctc
gagttcaagccggcgatcgggcacctcgcgctcacccacaacgtcgacatcctgcccctc
tacctgggcggcaccttcgaggcgctccccaaggggcgcaccgtcccgatccgccgcgac
ctcgtcgcgcgcatcgggccgccgctcgcgatcggcgacctccggcggctcaccgccggg
atgaagtacgcggtggcctgccgcaaggtcgcggagctcacgcagctcgccgtcatcaag
ctcaaggagggcggcgccctggatctgagccgggtcgagagcatcgatcaggccgccacc
accgccaaggagcacccgctcacgctcctgttccgcgagctcgagtcgaaatacgtggcg
gggcgggtcgcccagccgatcacctactacgtgacgctcggcacggaggacgaggcgaag
tggacgctgcggatcgacgcggccagctgcgaggcgcggatcggtaagccaagccagcaa
gcggactgtgtcctcaagaccacgcccgagatattcaccaagatcgtccgcgaggcctac
acgccgagcccgatggagttcatgacgggcctcgtgaaatcgaacgacatctccctcctg
cagaccttccagaaggttttcgacctcgcatga

DBGET integrated database retrieval system