KEGG   Spiroplasma clarkii: SCLARK_0030Help
Entry
SCLARK_0030       CDS       T05330                                 

Gene name
glpF1
Definition
(GenBank) glycerol uptake facilitator protein
  KO
K02440  glycerol uptake facilitator protein
Organism
scla  Spiroplasma clarkii
Brite
KEGG Orthology (KO) [BR:scla00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:scla02000]
    SCLARK_0030 (glpF1)
Transporters [BR:scla02000]
 Other transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaglyceroporins or glycerol-uptake facilitators
    SCLARK_0030 (glpF1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MIP
Motif
Other DBs
NCBI-ProteinID: ARU90865
UniProt: A0A1Y0KZE4
LinkDB All DBs
Position
complement(26537..27280)
Genome map
AA seq 247 aa AA seqDB search
MDNWLTYFMTETLGTMLLIVLGNGVVANIVLKNTKGNNGGWIAITAGWSFAVMLGATVSV
ALGGDAHLNPAVTMAMIVNGWESNVGHFGLIPIMLVGQILGAIVGQIIVDLFYIKHIHQT
ITEKEEGLVLAIHSTGPTYKNTFINCFCEFIGTSVLLVAIMATSAQFTDAGWMGPIFVGL
AVFAIGLSLGGTTGYAINPVRDLAPRLVHQFLPVKGKGSSDWKYSWIPVVAPLLAGCVIG
ALFLIKT
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggataattgattaacttattttatgacagaaactttaggaaccatgttattgatagtt
ttaggaaatggtgtggttgccaatatagttttaaaaaatacaaaaggtaataatggtgga
tgaatcgccattactgcagggtgatcttttgctgttatgttgggcgcaacagtatcagtt
gccttgggaggtgatgcacatttaaatcctgcagtaacaatggccatgattgtgaatggt
tgagagtcaaatgttgggcattttggactgattccaattatgttagtgggtcaaatccta
ggagcaattgttggtcaaataattgttgacttattttatattaaacatattcaccaaaca
atcactgaaaaagaggaaggtttagttttagcaatccacagtacaggtccaacttacaaa
aatacttttattaactgtttttgtgaatttattggaactagtgttttgctagttgctata
atggcaacctctgctcaatttacagatgcaggttgaatgggaccaatctttgtagggttg
gcagtatttgcaattggactttcattgggaggaactactggttatgcaattaacccagtt
agagatttagccccaagattagttcaccaatttttaccagtaaaaggtaaaggaagcagt
gactggaaatattcatgaattccagttgtagcaccattactagctggatgtgttattgga
gcattatttttaatcaaaacttaa

DBGET integrated database retrieval system