KEGG   Streptomyces clavuligerus: BB341_03015Help
Entry
BB341_03015       CDS       T04717                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
sclf  Streptomyces clavuligerus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: ANW17263
LinkDB All DBs
Position
complement(783586..784602)
Genome map
AA seq 338 aa AA seqDB search
MAAKALELEVGDRTVRVSNPDKVYFPERGYTKLDMVTYYLAVGEGITRALRDRPTTLERY
PDGVTGESFFQKRAPKYLPDWIPTAHITFPSGRSADEMCPTEPAAVVWAANLGAVTFHPW
PVRRADPDHPDELRLDLDPQPGTGYADAVRAAHELRAVLDEHGLCGWPKTSGGRGLHIFV
PIAPRWTFTQVRRAAIACGRELERRMPDRVTIKWWKEERGERIFVDYNQTARDRTIASAY
SVRPRPHAPVSAPLRWEEIDDAVPEDFDITTMPTRYAELGDVHADMDEHRFGLEPLLELA
RRDEAEHGLGDLPYPPEYPKMPGEPKRVQPSRARDPEG
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggcggccaaggcgctcgaactggaggtgggggaccggaccgtccgtgtctccaacccg
gacaaggtctactttcccgagcgcggctacaccaagctggacatggtcacctactacctc
gccgtcggcgagggcatcacccgtgccctgcgcgaccgccccaccaccctggagcgctac
cccgacggggtgacgggcgagtccttcttccagaagcgcgccccgaagtacctccccgac
tggattcccaccgcccacatcaccttccccagcggccggtccgccgacgagatgtgcccc
accgaaccggcggccgtggtgtgggccgccaacctcggcgcggtcaccttccacccctgg
ccggtccggcgcgccgaccccgaccaccccgacgaactgcggctcgacctcgacccgcag
cccggcaccggctacgccgacgccgtgcgcgccgcccatgagctgcgcgcggtcctcgac
gagcacggactgtgcggctggcccaagacctccggcgggcgcgggctgcacatcttcgtc
cccatcgcgccccggtggacgttcacccaggtccggcgggccgcgatcgcctgcggacgg
gaactggaacgcagaatgccggaccgggtcaccatcaagtggtggaaggaggagcgcggg
gaacggatcttcgtcgactacaaccagaccgcccgcgaccgcaccatcgcctccgcctac
tcggtgcgcccccgcccccacgccccggtctccgcgccgctgcgctgggaggagatcgac
gacgcggtgccggaggacttcgacatcaccaccatgccgacccgctacgccgagctgggc
gatgtccacgccgacatggacgaacaccgcttcggcctggagcccctgctggagctggcc
cgccgggacgaggccgagcacgggctcggcgatctgccctatccgccggagtacccgaag
atgcccggcgagcccaaacgggtccagcccagccgcgcccgcgacccggagggctga

DBGET integrated database retrieval system