KEGG   Streptomyces clavuligerus: BB341_03775Help
Entry
BB341_03775       CDS       T04717                                 

Definition
(GenBank) aminotransferase class III
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
sclf  Streptomyces clavuligerus
Pathway
sclf00250  Alanine, aspartate and glutamate metabolism
sclf00410  beta-Alanine metabolism
sclf00640  Propanoate metabolism
sclf00650  Butanoate metabolism
sclf01100  Metabolic pathways
sclf01120  Microbial metabolism in diverse environments
Module
sclf_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sclf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BB341_03775
   00650 Butanoate metabolism
    BB341_03775
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BB341_03775
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BB341_03775
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sclf01007]
    BB341_03775
Enzymes [BR:sclf01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     BB341_03775
Amino acid related enzymes [BR:sclf01007]
 Aminotransferase (transaminase)
  Class III
   BB341_03775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_5 Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ANW17405
LinkDB All DBs
Position
complement(971903..973180)
Genome map
AA seq 425 aa AA seqDB search
MSLLDRHRAVVPDWVALYYRDPIELVRGEGRHVWDADGRKYLDFFGGILTTMTAHALPEV
TKAVSEQAGRMIHSSTLYLNRPMVELAERVAALSGIPDARVFFTTSGTEANDTALLLATA
YRRSNQVLALRNSYHGRSFSAVSITGNRSWSPTSLSPLQTLYVHGGVRTRGPYAHLSDGE
FIAACVADLEDLLGHTREVAALIAEPVQGVGGFTSGPDGLLAAFREVLDRHGILWISDEV
QTGWGRTGDHFWGWQAHGAAGPPDLLTFAKGIGNGMSIGGVVASAEVMNALDANSISTFG
GSPVTMAAGLANLSYLLENDLQGNARRVGGLLLERLRAIGMTVPAVREVRGRGLMIGVEL
VRPGTEDADPEAASAVLEAARAGGLLIGKGGGHSTSVLRIAPPLTLTVAEAEEGAAVLEQ
ALRSL
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgctcgaccggcaccgcgccgtcgtccccgactgggtggcgctctactaccgg
gacccgatcgaactggtccgcggcgagggccgccatgtctgggacgccgacggcaggaag
tatctcgacttcttcggcggcatcctcaccaccatgaccgcccatgccctcccggaggtc
accaaggcggtgagcgagcaggccggacggatgatccactcgtccacgctctatctcaac
cgtcccatggtggaactggccgagcgggtcgccgccctctccggcatccccgacgcccgg
gtcttcttcaccacctcgggcaccgaggccaacgacaccgcactgctgctggcgaccgcg
taccgccgctccaaccaggtcctcgcgctgcgcaacagctaccacggccgctccttctcg
gcggtctccatcaccggcaaccggagctggtcgcccacctcgctctccccgctccagacg
ctgtacgtgcacggcggcgtccgcacccggggcccgtacgcgcacctttcggacggggag
ttcatcgcggcgtgcgtcgccgacctggaggacctgctcggccacacccgcgaggtcgcc
gccctgatcgccgagcccgtccagggcgtcggcgggttcacctcaggaccggacgggctg
ctcgccgccttccgggaggtgctggaccgccatggcatcctgtggatctccgacgaggtg
cagaccggctggggccgcaccggcgaccacttctggggctggcaggcccacggcgccgcg
ggaccgcccgatctgctcaccttcgccaagggcatcggcaacgggatgtccatcggcggt
gtcgtcgcctccgccgaggtcatgaacgccctggacgccaactccatctcgaccttcggc
ggttcccccgtcaccatggccgcgggcctcgccaacctctcctatctgctggagaacgac
ctccagggcaacgcccgccgggtcggcggcctgctgctcgaacggctgcgggcgatcggg
atgacggtcccggcggtccgggaggtacgcggccgggggctgatgatcggcgtcgaactg
gtccggcccggcaccgaggacgccgaccccgaagcggcgtcggcggtgctcgaagcggcc
cgcgcgggcggactcctcatcggcaagggcggcggccacagcaccagcgtgctgcggatc
gccccgcccctgaccctcaccgtcgccgaggcggaggagggcgccgccgtcctcgaacag
gccctgcggagcctgtag

DBGET integrated database retrieval system