KEGG   Streptomyces clavuligerus: BB341_07740
Entry
BB341_07740       CDS       T04717                                 

Definition
(GenBank) cephalosporin hydroxylase
  KO
K12744  deacetoxycephalosporin-C synthase [EC:1.14.20.1]
Organism
sclf  Streptomyces clavuligerus
Pathway
sclf00311  Penicillin and cephalosporin biosynthesis
sclf01100  Metabolic pathways
sclf01110  Biosynthesis of secondary metabolites
Module
sclf_M00673  Cephamycin C biosynthesis, aminoadipate + cycteine + valine => cephamycin C
Brite
KEGG Orthology (KO) [BR:sclf00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    BB341_07740
Enzymes [BR:sclf01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.20  With 2-oxoglutarate as one donor, and the other dehydrogenated
    1.14.20.1  deacetoxycephalosporin-C synthase
     BB341_07740
SSDB
Motif
Pfam: 2OG-FeII_Oxy DIOX_N
Other DBs
NCBI-ProteinID: ANW18122
UniProt: B5GLB0
LinkDB
Structure
PDB: 

Position
complement(2003590..2004525)
AA seq 311 aa
MDTTVPTFSLAELQQGLHQDEFRRCLRDKGLFYLTDCGLTDTELKSAKDIVIDFFEHGSE
AEKRAVTSPVPTMRRGFTGLESESTAQITNTGSYSDYSMCYSMGTADNLFPSGDFERIWT
QYFDRQYTASRAVAREVLRATGTEPDGGVEAFLDCEPLLRFRYFPQVPEHRSAEEQPLRM
APHYDLSMVTLIQQTPCANGFVSLQAEVGGAFTDLPYRPDAVLVFCGAIATLVTGGQVKA
PRHHVAAPRRDQIAGSSRTSSVFFLRPNADFTFSVPLARECGFDVSLDGETATFQDWIGG
NYVNIRRTSKA
NT seq 936 nt   +upstreamnt  +downstreamnt
atggacacgacggtgcccaccttcagcctggccgaactccagcagggcctgcaccaggac
gagttccgcaggtgtctgagggacaagggcctcttctatctgacggactgcggtctgacc
gacaccgagctgaagtcggccaaggacatcgtcatcgacttcttcgagcacggcagcgag
gcggagaagcgcgccgtcacctcgcccgtccccaccatgcgccgcggcttcaccgggctg
gagtcggagagcaccgcccagatcaccaataccggcagctactccgactactcgatgtgc
tactcgatgggcaccgcggacaacctcttcccgtccggtgacttcgagcggatctggacc
cagtacttcgaccgccagtacaccgcctcccgcgcggtcgcccgggaggtcctgcgggcg
accgggaccgagcccgacggcggggtcgaggccttcctcgactgcgagccgctgctgcgg
ttccgctacttcccgcaggtccccgagcaccgcagcgccgaggagcagcccctgcggatg
gcgccgcactacgacctgtcgatggtcaccctcatccagcagacaccctgcgccaacggc
ttcgtcagcctccaggccgaggtcggcggcgcgttcacggacctgccctaccgtccggac
gccgtcctcgtcttctgcggcgccatcgcgaccctggtgaccggcggccaggtcaaggcc
ccccggcaccatgtcgcggccccccgcagggaccagatagcgggcagcagccgcacctcc
agtgtgttcttcctccgtcccaacgcggacttcaccttctccgtcccgctggcgcgcgag
tgcggcttcgatgtcagcctggacggcgagaccgccacgttccaggattggatcgggggc
aactacgtgaacatccgccgcacatccaaggcatag

DBGET integrated database retrieval system