KEGG   Streptomyces clavuligerus: BB341_07810
Entry
BB341_07810       CDS       T04717                                 

Definition
(GenBank) asparagine synthase
  KO
K12674  (carboxyethyl)arginine beta-lactam-synthase [EC:6.3.3.4]
Organism
sclf  Streptomyces clavuligerus
Pathway
sclf00331  Clavulanic acid biosynthesis
sclf01100  Metabolic pathways
sclf01110  Biosynthesis of secondary metabolites
Module
sclf_M00674  Clavaminate biosynthesis, arginine + glyceraldehyde-3P => clavaminate
Brite
KEGG Orthology (KO) [BR:sclf00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00331 Clavulanic acid biosynthesis
    BB341_07810
Enzymes [BR:sclf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.3  Cyclo-ligases
    6.3.3.4  (carboxyethyl)arginine beta-lactam-synthase
     BB341_07810
SSDB
Motif
Pfam: Asn_synthase GATase_7 GATase_6 NAD_synthase QueC
Other DBs
NCBI-ProteinID: ANW18136
UniProt: B5GLC7
LinkDB
Structure
PDB: 
1M1Z 1JGT 1MB9 1MC1 1MBZ

Position
2033377..2034918
AA seq 513 aa
MGAPVLPAAFGFLASARTGGGRAPGPVFATRGSHTDIDTPQGERSLAATLVHAPSVAPDR
AVARSLTGAPTTAVLAGEIYNRDELLSVLPAGPAPEGDAELVLRLLERYDLHAFRLVNGR
FATVVRTGDRVLLATDHAGSVPLYTCVAPGEVRASTEAKALAAHRDPKGFPLADARRVAG
LTGVYQVPAGAVMDIDLGSGTAVTHRTWTPGLSRRILPEGEAVAAVRAALEKAVAQRVTP
GDTPLVVLSGGIDSSGVAACAHRAAGELDTVSMGTDTSNEFREARAVVDHLRTRHREITI
PTTELLAQLPYAVWASESVDPDIIEYLLPLTALYRALDGPERRILTGYGADIPLGGMHRE
DRLPALDTVLAHDMATFDGLNEMSPVLSTLAGHWTTHPYWDREVLDLLVSLEAGLKRRHG
RDKWVLRAAMADALPAETVNRPKLGVHEGSGTTSSFSRLLLDHGVAEDRVHEAKRQVVRE
LFDLTVGGGRHPSEVDTDDVVRSVADRTARGAA
NT seq 1542 nt   +upstreamnt  +downstreamnt
atgggggcaccggttcttccggctgccttcgggttcctggcctccgcccgaacgggcggg
ggccgggcccccggcccggtcttcgcgacccggggcagccacaccgacatcgacacgccc
cagggggagcgctcgctcgcggcgaccctggtgcacgccccctcggtcgcgcccgaccgc
gcggtggcgcgctccctcaccggcgcgcccaccaccgcggtgctcgccggtgagatctac
aaccgggacgaactcctctccgtgctgcccgccggacccgcgccggagggggacgcggag
ctggtcctgcggctgctggaacgctatgacctgcatgccttccggctggtgaacgggcgc
ttcgcgaccgtggtgcggaccggggaccgggtcctgctcgccaccgaccacgccggttcg
gtgccgctgtacacctgtgtggcgccgggcgaggtccgggcgtccaccgaggccaaggcg
ctcgccgcgcaccgcgacccgaagggcttcccgctcgcggacgcccgccgggtcgccggt
ctgaccggtgtctaccaggtgcccgcgggcgccgtgatggacatcgacctcggctcgggc
accgccgtcacccaccgcacctggaccccgggcctctcccgccgcatcctgccggagggc
gaggccgtcgcggccgtgcgggccgcgctggagaaggccgtcgcccagcgggtcaccccc
ggcgacaccccgttggtggtgctctccggcggaatcgactcctccggggtcgcggcctgt
gcgcaccgggcggccggggaactggacacggtgtccatgggcaccgacacgtccaacgag
ttccgcgaggcccgggcggtcgtcgaccatctgcgcacccggcaccgggagatcaccatc
ccgaccaccgagctgctggcgcagctcccgtacgcggtgtgggcctccgagtcggtggac
ccggacatcatcgagtacctgctccccctgacagcgctctaccgggcgctcgacgggccg
gagcgccgcatcctcaccgggtacggcgcggacatccccctcgggggcatgcaccgcgag
gaccggctgcccgcgctggacaccgttctcgcgcacgacatggccaccttcgacgggctg
aacgagatgtccccggtgctgtccacgctggcggggcactggaccacccacccgtactgg
gaccgggaggtcctcgatctgctggtctcgctggaggccgggctcaagcggcggcacggc
cgggacaagtgggtgctgcgcgccgcgatggccgacgccctcccggcggagaccgtcaac
cggcccaagctgggcgtccacgagggctcgggcaccacgtcctcgttctcccggctgctg
ctggaccacggtgtcgccgaggaccgcgtccacgaggcgaagcggcaggtggtgcgcgag
ctgttcgatctcacggtcgggggcggacggcacccctccgaggtggacaccgacgatgtg
gtgcgctccgtggccgaccggaccgcgcggggggcggcctag

DBGET integrated database retrieval system