KEGG   Streptomyces clavuligerus: BB341_07820
Entry
BB341_07820       CDS       T04717                                 
Name
(GenBank) clavaminate synthase
  KO
K12675  clavaminate synthase [EC:1.14.11.21]
Organism
sclf  Streptomyces clavuligerus
Pathway
sclf00331  Clavulanic acid biosynthesis
sclf01100  Metabolic pathways
sclf01110  Biosynthesis of secondary metabolites
Module
sclf_M00674  Clavaminate biosynthesis, arginine + glyceraldehyde-3P => clavaminate
Brite
KEGG Orthology (KO) [BR:sclf00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00331 Clavulanic acid biosynthesis
    BB341_07820
Enzymes [BR:sclf01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.21  clavaminate synthase
     BB341_07820
SSDB
Motif
Pfam: TauD CsiD
Other DBs
NCBI-ProteinID: ANW18138
UniProt: Q53939
LinkDB
Position
2036048..2037025
AA seq 325 aa
MASPIVDCTPYRDELLALASELPEVPRADLHGFLDEAKTLAARLPEGLAAALDTFNAVGS
EDGYLLLRGLPVDDSELPETPTSTPAPLDRKRLVMEAMLALAGRRLGLHTGYQELRSGTV
YHDVYPSPGAHYLSSETSETLLEFHTEMAYHILQPNYVMLACSRADHENRAETLVGSVRK
ALPLLDEKTRARLFDRKVPCCVDVAFRGGVDDPGAIANVKPLYGDANDPFLGYDRELLAP
EDPADKEAVAHLSQALDDVTVGVKLVPGDVLIIDNFRTTHARTPFSPRWDGKDRWLHRVY
IRTDRNGQLSGGERAGDTISFSPRR
NT seq 978 nt   +upstreamnt  +downstreamnt
atggcctctccgatagttgactgcaccccgtaccgcgacgagctgctcgcgctcgcctcc
gagcttcccgaggtgccgcgcgcggacctccatggcttcctcgacgaggcgaagacgctg
gccgcccgtctcccggaggggctggccgccgctctcgacaccttcaacgccgtgggcagc
gaggacggttatctgctgctgcgcgggctgcccgtcgacgacagcgagctgcccgagacg
ccgacctccaccccggccccgctggaccgcaagcggctggtgatggaggccatgctcgcg
ctggccggccgccggctcggtctgcacacggggtaccaggagctgcgctcgggcacggtc
taccacgacgtgtacccgtcgcccggcgcgcactacctgtcctcggagacctccgagacg
ctgctggagttccacacggagatggcgtaccacatcctccagccgaactacgtcatgctg
gcctgctcccgcgcggaccacgagaaccgggcggagacgctggtcggctcggtccgcaag
gcgctgcccctgctggacgagaagacccgggcccgtctcttcgaccgcaaggtgccctgc
tgcgtggacgtggccttccgcggcggggtcgacgacccgggcgcgatcgccaacgtcaag
ccgctctacggggacgcgaacgacccgttcctcgggtacgaccgcgagctgctggcgccg
gaggaccccgcggacaaggaggccgtcgcccatctgtcccaggcgctcgacgatgtgacc
gtcggggtgaagctcgtccccggtgacgtcctcatcatcgacaacttccgcaccacgcac
gcgcggacgccgttctcgccccgctgggacgggaaggaccgctggctgcaccgcgtctac
atccgcaccgaccgcaatggacagctctccggcggcgagcgcgcgggcgacaccatctcg
ttctcgccgcgccgctga

KEGG   Streptomyces clavuligerus: BB341_13950
Entry
BB341_13950       CDS       T04717                                 
Name
(GenBank) clavaminate synthase
  KO
K12675  clavaminate synthase [EC:1.14.11.21]
Organism
sclf  Streptomyces clavuligerus
Pathway
sclf00331  Clavulanic acid biosynthesis
sclf01100  Metabolic pathways
sclf01110  Biosynthesis of secondary metabolites
Module
sclf_M00674  Clavaminate biosynthesis, arginine + glyceraldehyde-3P => clavaminate
Brite
KEGG Orthology (KO) [BR:sclf00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00331 Clavulanic acid biosynthesis
    BB341_13950
Enzymes [BR:sclf01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.21  clavaminate synthase
     BB341_13950
SSDB
Motif
Pfam: TauD CsiD
Other DBs
NCBI-ProteinID: ANW19243
UniProt: E2PWJ7
LinkDB
Position
3447138..3448112
AA seq 324 aa
MTSVDCTAYGPELRALAARLPRTPRADLYAFLDAAHTAAASLPGALATALDTFNAEGSED
GHLLLRGLPVEADADLPTTPSSTPAPEDRSLLTMEAMLGLVGRRLGLHTGYRELRSGTVY
HDVYPSPGAHHLSSETSETLLEFHTEMAYHRLQPNYVMLACSRADHERTAATLVASVRKA
LPLLDERTRARLLDRRMPCCVDVAFRGGVDDPGAIAQVKPLYGDADDPFLGYDRELLAPE
DPADKEAVAALSKALDEVTEAVYLEPGDLLIVDNFRTTHARTPFSPRWDGKDRWLHRVYI
RTDRNGQLSGGERAGDVVAFTPRG
NT seq 975 nt   +upstreamnt  +downstreamnt
atgacctcagtggactgcaccgcgtacggccccgagctgcgcgcgctcgccgcccggctg
ccccggaccccccgggccgacctgtacgccttcctggacgccgcgcacacagccgccgcc
tcgctccccggcgccctcgccaccgcgctggacaccttcaacgccgagggcagcgaggac
ggccatctgctgctgcgcggcctcccggtggaggccgacgccgacctccccaccaccccg
agcagcaccccggcgcccgaggaccgctccctgctgaccatggaggccatgctcggactg
gtgggccgccggctcggtctgcacacggggtaccgggagctgcgctcgggcacggtctac
cacgacgtgtacccgtcgcccggcgcgcaccacctgtcctcggagacctccgagacgctg
ctggagttccacacggagatggcctaccaccggctccagccgaactacgtcatgctggcc
tgctcccgggccgaccacgagcgcacggcggccacactcgtcgcctcggtccgcaaggcg
ctgcccctgctggacgagaggacccgggcccggctcctcgaccggaggatgccctgctgc
gtggatgtggccttccgcggcggggtggacgacccgggcgccatcgcccaggtcaaaccg
ctctacggggacgcggacgatcccttcctcgggtacgaccgcgagctgctggcgccggag
gaccccgcggacaaggaggccgtcgccgccctgtccaaggcgctcgacgaggtcacggag
gcggtgtatctggagcccggcgatctgctgatcgtcgacaacttccgcaccacgcacgcg
cggacgccgttctcgccccgctgggacgggaaggaccgctggctgcaccgcgtctacatc
cgcaccgaccgcaatggacagctctccggcggcgagcgcgcgggcgacgtcgtcgccttc
acaccgcgcggctga

DBGET integrated database retrieval system