KEGG   Streptomyces clavuligerus: BB341_09845Help
Entry
BB341_09845       CDS       T04717                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
sclf  Streptomyces clavuligerus
Pathway
sclf00020  Citrate cycle (TCA cycle)
sclf00190  Oxidative phosphorylation
sclf00650  Butanoate metabolism
sclf01100  Metabolic pathways
sclf01110  Biosynthesis of secondary metabolites
sclf01120  Microbial metabolism in diverse environments
sclf01130  Biosynthesis of antibiotics
sclf01200  Carbon metabolism
Module
sclf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sclf_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sclf_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sclf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BB341_09845
   00650 Butanoate metabolism
    BB341_09845
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BB341_09845
Enzymes [BR:sclf01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BB341_09845
    1.3.5.4  fumarate reductase (quinol)
     BB341_09845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 HI0933_like DAO Pyr_redox_2 Pyr_redox_3 FAD_oxidored GIDA
Motif
Other DBs
NCBI-ProteinID: ANW18513
LinkDB All DBs
Position
2510587..2512341
Genome map
AA seq 584 aa AA seqDB search
MKIHKYDTVIVGAGGAGMRAAIEATKRSRTAVLTKLYPTRSHTGAAQGGMAAALANVEED
NWEWHTFDTVKGGDYLVDQDAAEILAKEAIDAVLDLEKMGLPFNRTPNGTIDQRRFGGHS
RNHGEAPVRRSCYAADRTGHMILQTLYQNCVKEGVEFFNEFYVLDQLITEVDGVKHSAGV
VAYELATGEIHVFQAKAVIYASGGTGKFFKVTSNAHTLTGDGQAACYRRGLPLEDMEFFQ
FHPTGIWRMGILLTEGARGEGGILRNKDGERFMEKYAPVMKDLASRDVVSRSIYTEIREG
RGCGPEGDHVYLDLTHLPPEQLDAKLPDITEFARTYLGIEPYTDPIPIQPTAHYAMGGIP
TNVEGEVLSDNTTVVPGLYAAGEVACVSVHGANRLGTNSLLDINVFGRRAGIAAAEYSAT
AEWVELPEDPASLVVKTVEDLRESEGGERVADIRRELQETMDANVMVFRTEQTIKTAVEK
IAELRERYRNVAIQDKGKRFNTDLLEAIELGNLLELAEVMAVSALARKESRGGHYREDYP
NRDDVNFMRHTMAYREVGDDGSETVRLDYKPVVQTRYQPMERKY
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgaagatccacaagtacgacaccgtcatcgtcggcgccggtggcgcaggcatgcgcgcc
gccatcgaggcgacgaagcgcagccgcaccgccgtgctgacgaagctctaccccacccgc
tcccacacgggcgccgcgcagggcggcatggccgccgcgctcgccaatgtggaggaggac
aactgggagtggcacaccttcgacacggtcaagggcggtgactacctggtcgaccaggac
gccgccgagatcctggcgaaggaggccatcgacgccgtcctcgacctggagaagatgggc
ctgccgttcaaccggaccccgaacggcaccatcgaccagcgccgcttcggcgggcactcg
cgcaaccacggcgaggccccggtccgccgctcctgctacgccgccgaccgcaccggtcat
atgatcctccagacgctgtatcagaactgcgtcaaggagggcgtggagttcttcaacgag
ttctacgtcctggaccagctcatcaccgaggtcgacggcgtcaagcactcggccggtgtg
gtcgcgtacgagctggccaccggcgagatccatgtcttccaggcgaaggccgtgatctac
gcctccggcggcaccggcaagttcttcaaggtgacctccaacgcgcacaccctcaccggt
gacggccaggcggcctgctaccggcgcggcctgccgctggaggacatggagttcttccag
ttccacccgacgggcatctggcgcatgggcatcctgctcacggagggcgcccgcggtgag
ggcggcatcctgcgcaacaaggacggcgagcgcttcatggagaagtacgcgcccgtcatg
aaggacctcgcctcgcgcgacgtcgtctcccgctccatctacacggagatccgcgagggc
cgcggctgcggtcccgagggcgaccacgtctacctggacctgacccacctgccgccggag
cagctcgacgccaagctcccggacatcaccgagttcgcgcggacctacctcggcatcgag
ccctacacggacccgattccgatccagccgaccgcgcactacgccatgggcggcatcccg
accaatgtcgagggtgaggtgctgtccgacaacaccaccgtcgtgccgggtctgtacgcc
gccggtgaggtcgcctgtgtctccgtgcacggcgccaaccggctgggcaccaactcgctg
ctggacatcaatgtcttcggccgccgcgcgggcatcgccgccgcggagtactccgccacg
gccgagtgggtcgagctgccggaggaccccgcctcgctcgtcgtgaagacggtggaggac
ctgcgggagtccgagggcggcgagcgcgtggcggacatccgccgcgagctccaggagacc
atggacgccaatgtcatggtcttccgcaccgagcagacgatcaagaccgcggtcgagaag
atcgcggagctgcgcgagcgctaccggaacgtggcgatccaggacaagggcaagcggttc
aacacggacctgctggaggccatcgagctgggcaacctgctggagctggccgaggtcatg
gccgtctccgcgctggcccgcaaggagtcccgcggcggtcactaccgcgaggactacccg
aaccgcgacgacgtcaacttcatgcgccacaccatggcgtaccgcgaggtcggcgacgac
ggctccgagaccgtccgtctcgactacaagccggtcgtccagacccgctaccagccgatg
gagcgtaagtactga

DBGET integrated database retrieval system