KEGG   Streptomyces clavuligerus: BB341_09850Help
Entry
BB341_09850       CDS       T04717                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
sclf  Streptomyces clavuligerus
Pathway
sclf00020  Citrate cycle (TCA cycle)
sclf00190  Oxidative phosphorylation
sclf00650  Butanoate metabolism
sclf01100  Metabolic pathways
sclf01110  Biosynthesis of secondary metabolites
sclf01120  Microbial metabolism in diverse environments
sclf01130  Biosynthesis of antibiotics
sclf01200  Carbon metabolism
Module
sclf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sclf_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sclf_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sclf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BB341_09850
   00650 Butanoate metabolism
    BB341_09850
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BB341_09850
Enzymes [BR:sclf01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BB341_09850
    1.3.5.4  fumarate reductase (quinol)
     BB341_09850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_17 Fer4_7 Fer4_9 Fer4_16 Fer4 Fer4_18 Fer4_4 Fer4_6 Fer4_2 Fer4_15 Fer4_21
Motif
Other DBs
NCBI-ProteinID: ANW18514
LinkDB All DBs
Position
2512341..2513099
Genome map
AA seq 252 aa AA seqDB search
MATPVMDKVEAEAAASPYITVTFRIRRFNPEISEHAVWEDFELEIDPKERVLDGLHKIKW
DQDGTLTFRRSCAHGICGSDAMRINGKNRLACKTLIKDLNPEKPITVEAIKGLTVLKDLV
VDMEPFFQAYRDVMPFLVTEGNEPTRERLQTAEDRERFDDTTKCILCAACTTSCPVFWND
GQYFGPAAIVNAHRFIFDSRDEAGEQRLEILNDKDGVWRCRTTFNCTDACPRGIEVTKAI
QEVKRALITRRY
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggctacccctgtcatggacaaggtcgaggccgaggccgcggcctccccgtacatcacc
gtcaccttccggatccggcgcttcaacccggagatctccgagcacgcggtctgggaggac
ttcgagctggagatcgacccgaaggagcgggtcctcgacggcctccacaagatcaagtgg
gaccaggacggcacgctgaccttccgccgctcctgcgcccatggcatctgcggctccgac
gcgatgcggatcaacggcaagaacaggctcgcctgcaagacgctgatcaaggatctcaac
ccggagaagcccatcacggtcgaggccatcaagggcctgacggtcctcaaggacctcgtc
gtggacatggagccgttcttccaggcgtaccgcgatgtgatgccgttcctcgtcaccgag
gggaacgagcccacccgcgagcggctccagaccgctgaggaccgcgagcgcttcgacgac
accacgaagtgcatcctgtgcgcggcctgcaccacgtcctgcccggtcttctggaacgac
ggccagtacttcggcccggcggccatcgtcaacgcccaccgcttcatcttcgactcgcgt
gacgaggccggtgagcagcggctggagatcctgaacgacaaggacggcgtctggcgctgc
cgtacgaccttcaactgcacggacgcctgcccgcgcggtatcgaggtcacgaaggccatc
caggaggtcaagcgcgcgctgatcacccgccgttactga

DBGET integrated database retrieval system