KEGG   Streptomyces clavuligerus: BB341_09975Help
Entry
BB341_09975       CDS       T04717                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
sclf  Streptomyces clavuligerus
Pathway
sclf00020  Citrate cycle (TCA cycle)
sclf00270  Cysteine and methionine metabolism
sclf00620  Pyruvate metabolism
sclf00630  Glyoxylate and dicarboxylate metabolism
sclf00680  Methane metabolism
sclf01100  Metabolic pathways
sclf01110  Biosynthesis of secondary metabolites
sclf01120  Microbial metabolism in diverse environments
sclf01130  Biosynthesis of antibiotics
sclf01200  Carbon metabolism
Module
sclf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sclf_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sclf_M00012  Glyoxylate cycle
sclf_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sclf00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BB341_09975
   00620 Pyruvate metabolism
    BB341_09975
   00630 Glyoxylate and dicarboxylate metabolism
    BB341_09975
  Energy metabolism
   00680 Methane metabolism
    BB341_09975
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BB341_09975
Enzymes [BR:sclf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     BB341_09975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_C Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: ANW18535
LinkDB All DBs
Position
complement(2536015..2537004)
Genome map
AA seq 329 aa AA seqDB search
MTRTPVNVTVTGAAGQIGYALLFRIASGHLLGPDVPVKLRLLEITPALGAAQGTAMELDD
CAFPLLRGIDITDDPNVAFDGANVALLVGARPRTKGMERGDLLEANGGIFKPQGKAINDH
AADDIKVLVVGNPANTNALIAQAAAPDVPAERFTAMTRLDHNRALSQLAAKTGTTVADIK
RLTIWGNHSATQYPDIFHAEIAGKNAAEVVNDQAWLADTFIPTVAKRGAAIIEARGASSA
ASAANAAIDHVHTWVNGTAEGDWTSMGIPSDGSYGVPEGLISSFPVTVKDGRYEIVQGLE
INEFSRTRIDASVQELAEERDAVRALGLI
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcactcccgtcaacgtcaccgtgaccggcgcggccggccagatcggttacgcg
ctgctgttccgtatcgcctccggccatctgctcggcccggacgttccggtcaagctgcgc
cttctggagatcaccccggctctcggcgccgcccagggcaccgccatggagctggacgac
tgcgccttcccgctgctgcgcggcatcgacatcaccgacgacccgaacgtggccttcgac
ggtgcgaacgtcgccctgctggtcggcgcccgcccccgcaccaagggcatggagcgcggt
gacctgctggaggccaacggcggcatcttcaagccgcagggcaaggccatcaacgaccac
gcggcggacgacatcaaggtgctcgtcgtcggcaacccggccaacaccaacgcgctgatc
gcgcaggccgccgccccggacgtaccggcggagcgcttcaccgcgatgacccgtctcgac
cacaaccgcgccctctcgcagctcgccgcgaagaccggtacgaccgtggccgacatcaag
cggctgacgatctggggcaaccactcggccactcagtacccggacatcttccacgcggag
atcgcgggcaagaacgccgccgaggtcgtgaacgaccaggcgtggctggccgacacgttc
atcccgaccgtcgccaagcgcggtgcggcgatcatcgaggcgcggggcgcgtcctccgcc
gcgtccgccgccaacgccgcgatcgaccacgtccacacgtgggtcaacggcaccgccgag
ggcgactggacctcgatgggtatcccgtcggacggctcctacggcgtcccggagggcctg
atctcctccttcccggtcaccgtgaaggacggccgctacgagatcgtccagggcctggag
atcaacgagttctcccggacccggatcgacgcctccgtgcaggagctggcggaggagcgc
gacgcggtgcgcgcgctcggcctgatctga

DBGET integrated database retrieval system