KEGG   Streptomyces clavuligerus: BB341_17140Help
Entry
BB341_17140       CDS       T04717                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sclf  Streptomyces clavuligerus
Pathway
sclf00620  Pyruvate metabolism
sclf00680  Methane metabolism
sclf01100  Metabolic pathways
sclf01120  Microbial metabolism in diverse environments
sclf01200  Carbon metabolism
Module
sclf_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sclf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BB341_17140
  09102 Energy metabolism
   00680 Methane metabolism
    BB341_17140
Enzymes [BR:sclf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BB341_17140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ANW19822
LinkDB All DBs
Position
4226909..4229638
Genome map
AA seq 909 aa AA seqDB search
MSSADQTPTASAELRADIRRLGDLLGETIVRQEGPELLELVEQVRALTRSDGEAAAHLLG
DTDLETAAKLVRAFSTYFHLANVTEQVHRGHELRRLRAAEGSLLARTADRLKDADPAHLR
ETVKNLNVRPVFTAHPTEAARRSVLNKLRRIAELLDTPAVPSDRRRIDLRLAENIDLIWQ
TDELRVVRPEPADEARNAIYYLDELHADAVGDVLEDLAAELERVGLELPAGTRPLTFGTW
IGGDRDGNPNVTPAVTREVLILQHEHGITDALALIDALRGQLSQSIRYTGATDELLASLQ
TDLERLPEISPRYKRLNAEEPYRLKATCIQQKLVNTRERLAKGTPHQPGRDYLGTSELLA
DLTLIQTSLREHRAGLFADGRLDRTIRTLSAFGLQLATMDVREHADAHHHALGQLFDRLG
EESWRYSDMPREYRQKLLAKELRSRRPLAPTPAPLDAAGAKTLGVFHTVKEAFERFGPEV
IESYIISMCQGADDVFAAAVLAREAGLIDLHAGWAKIGIVPLLETTDELRAADVILDGML
SDPSYRRLVALRGEVQEVMLGYSDSSKFGGITTSQWEIHRAQRRLRDVAHRHGVRLRLFH
GRGGTVGRGGGPTHDAILAQPWGTLEGEIKVTEQGEVISDKYLIPSLARENLELTVSATL
QASALHTAPRQSVEALARWDAAMDTVSDAAHRVYRALVEDPDLPAYFFASTPVDQLADLH
LGSRPSRRPDSGAGLDGLRAIPWVFGWTQSRQIVPGWYGVGSGLKALREAGLDTVLSEMH
EQWHFFRNFIANVEMTLAKTDLRIARHYVDTLVPDELKHVFDTIEAEHRLTVSEVLKVTG
GERLLGSNPVLQQTFAIRDAYLDPISYLQVSLLARQRGAAERGEPADPLLGRALLLTVNG
VAAGLRNTG
NT seq 2730 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagtgccgaccagacacccacggccagcgccgaactccgtgccgacatccgccga
ctgggcgacctcctcggggagacgatcgtccggcaggaaggccccgaactgctcgaactc
gtcgagcaggtacgcgccctgacccgcagcgacggggaggccgccgcccatctgctgggc
gacaccgacctggagaccgcggccaagctggtccgcgccttctccacctacttccacctc
gccaacgtcaccgaacaggtgcaccgcggccatgagctgcgccgactgcgcgcggccgag
ggcagcctgctggcccgtaccgccgaccggctcaaggacgccgaccccgcccatctgcgg
gagaccgtcaagaacctcaacgtccggcccgtcttcaccgcgcaccccacggaggccgcc
cggcgctccgtcctcaacaagctgcgccggatcgccgaactcctcgacacccccgcggtc
ccctccgaccgccgccgcatcgatctgcggctcgccgagaacatcgacctcatctggcag
accgacgagctgcgggtcgtccgccccgaaccggccgacgaggcccgcaacgccatctac
tacctggacgagctgcacgccgacgccgtcggcgacgtcctggaggacctggcggcggag
ctggagcgggtcggcctggagctgcccgcgggcacccgcccgttgaccttcggcacctgg
atcggcggcgaccgcgacggcaaccccaacgtcacccccgccgtcacccgcgaggtgctg
atcctccagcacgagcacggcatcaccgacgccctcgccctcatcgacgcgctgcgcgga
cagctctcccagtccatccgctacaccggcgccaccgacgaactcctcgcctccctccag
accgacctggagcggctgccggagatcagcccccgctacaagcggctcaacgcggaggag
ccgtaccgcctcaaggccacctgcatccagcagaagctcgtcaacacccgcgagcgcctg
gccaagggcaccccgcaccagcccggacgggactacctcggcacctccgaactcctcgcc
gacctcaccctgatccagacctcgctgcgcgagcaccgggccgggctcttcgccgacggc
cgcctcgaccgcaccatccgcacgctctccgcgttcggcctccagctcgccaccatggac
gtgcgcgaacacgcggacgcccaccaccacgccctcggccagctcttcgaccggctcggc
gaggagtcctggcggtactccgacatgccgcgcgagtaccggcagaagctgctcgcgaag
gagctgcgctcgcgccgcccgctcgcgcccacccccgccccgctggacgccgccggtgcc
aagaccctcggggtcttccacaccgtcaaggaggcgttcgagcggttcgggcccgaggtc
atcgagtcgtacatcatctcgatgtgccagggcgccgacgatgtcttcgccgccgccgtc
ctcgcccgcgaggccggactcatcgacctccacgcgggctgggcgaagatcggcatcgtg
cccctcctggagaccacggacgagctgcgcgccgccgatgtgatcctggacgggatgctc
tccgacccctcctaccgcaggctcgtcgcgctccgcggcgaggtccaggaggtcatgctc
ggctactccgactcctccaagttcggcggcatcaccacctcgcagtgggagatccaccgg
gcccagcggcgactgcgcgacgtggcccaccgccacggggtgcggctgcggctcttccac
ggccgcggcggcaccgtcggccgcggcggcggccccacccacgacgcgatcctggcgcag
ccctggggcacgctggagggcgagatcaaggtgaccgagcagggcgaggtcatctccgac
aagtatctgatcccgtccctggcccgggagaacctggaactgacggtctccgccacgctc
caggcgtccgccctgcacaccgcgccgcgccagtccgtggaggcgctggcccgctgggac
gccgcgatggacaccgtctcggacgccgcgcaccgcgtgtaccgcgccctggtcgaggac
ccggacctgcccgcgtacttcttcgcgtcgacccccgtcgaccagctcgccgatctgcac
ctgggctcgcgcccctcgcgccgccccgacagcggcgccgggctcgacgggctgcgggcg
atcccgtgggtcttcggctggacccagtcccggcagatcgtccccggctggtacggggtc
ggctccgggctgaaggcgctgcgggaggccggactcgacaccgtcctgtcggagatgcac
gagcagtggcacttcttccgcaacttcatcgcgaacgtggagatgacgctcgcgaagacg
gatctgcggatcgcccggcactacgtcgacaccctggtgccggacgagctgaagcatgtc
ttcgacacgatcgaggccgagcaccggctgaccgtgagcgaggtcctgaaggtcaccggc
ggggagcggctgctcggctccaacccggtgctccagcagacgttcgccatccgggacgcc
tatctggacccgatctcctatctccaggtctccctgctggcccgccagcgcggtgccgcg
gagcgcggtgagcccgccgacccgctgctgggccgtgccctgctgctcaccgtcaacggg
gtggccgcgggtctgcgcaacaccggctga

DBGET integrated database retrieval system