KEGG   Streptomyces clavuligerus: BB341_20440Help
Entry
BB341_20440       CDS       T04717                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
sclf  Streptomyces clavuligerus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: ANW20408
LinkDB All DBs
Position
5032581..5034101
Genome map
AA seq 506 aa AA seqDB search
MTDFVEHGKLFIGGALTDPLGTGTIDVVSPHSEEIIGRVPHASRADVDAAVATARKAFDE
GPWPRMTLDERIAVVTRIKDGVAARHEELARLVSSQNGSPYSWSVFAQALGPVMIWDAAI
TAARATVHEERRAGMLGPLVVRREPVGVVAAVMPWNVPQFTAASKLAPALLAGCTAILKP
SPEAPLDSYLLAEIIQEAGLPAGVLSILPADREVSEYLVGHPGVDKVSFTGSVAAGKRVM
EVASRHLTRVTLELGGKSAAVILPDADIAASVAGITPAAWLNNGQACVAQTRVLAPRSRY
DEIAEALTAAAEALVVGDPLDPATQVGPLVAQRQQQRSFDYIELGRTAGAKLLTGGGRPA
ARDRGWYVEPTLFGEVDNGMRIAREEIFGPVICLLPYGDEEEAARIANDSDFGLSGSVWT
ADTDRGLDFARRIRTGTYSVNTFGVDLGAPFGGYKNSGLGREMGVEGYAAYLELKTIHLP
AGSGGAEDAETTGTTGTTGTVEPTDG
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacttcgtggaacacggaaagctgttcatcggcggcgcgctgaccgacccgttg
ggcaccgggaccatcgatgtggtctcgccccacagcgaggagatcatcggccgcgtcccg
cacgcctcccgcgccgacgtcgacgcggcggtcgccaccgcccgcaaggcgttcgacgag
ggcccctggccccggatgaccctcgacgaacgcatagccgtcgtcacccggatcaaggac
ggggtcgccgcccgccacgaggagctggcccggctggtcagctcccagaacggctccccg
tactcctggagcgtcttcgcccaggcgctcgggcccgtgatgatctgggacgcggccatc
accgccgcccgcgccaccgtccacgaggagcggcgcgccgggatgctcggcccgctcgtg
gtgcggcgggagcccgtcggcgtcgtcgcggcggtgatgccgtggaacgtgccgcagttc
acggcggcgtccaagctggcccccgcgctgctcgcgggctgcacggcgatcctcaagccg
tcccccgaggcgcccctcgactcctatctcctcgcggagatcatccaggaggcggggctc
ccggcgggcgtgctctcgatccttccggcggaccgcgaggtcagcgagtacctcgtgggc
caccccggtgtcgacaaggtctccttcaccggctcggtggccgcgggcaaacgggtgatg
gaggtcgcctcccgccatctcacccgcgtcaccctcgaactgggcggcaagtccgccgcg
gtgatcctgcccgacgccgacatcgcggcctcggtggccgggatcacccccgccgcctgg
ctcaacaacggacaggcgtgtgtggcccagacccgggtgctcgccccccgcagccggtac
gacgagatcgccgaggccctgacggcggcggccgaggcgctggtcgtcggcgacccgctg
gacccggcgacccaggtcggcccgctcgtcgcgcagcgccagcagcagcgctcgttcgac
tacatcgaactgggccgcacggccggggcgaagctgctcaccggcggcgggcgcccggcc
gcgcgggaccgcggctggtatgtcgaacccaccctcttcggcgaggtcgacaacggtatg
cggatcgcccgcgaggagatcttcggaccggtgatctgtctgctgccgtacggggacgag
gaggaggccgcgcggatcgcgaacgactccgacttcgggctcagcggcagcgtctggacc
gccgacaccgatcgcgggctcgacttcgcccgccggatcaggacggggacgtactcggtc
aacacattcggcgtggacctgggggcgccgttcgggggatacaagaactccggtctgggg
cgggagatgggtgtcgaggggtacgccgcctaccttgagctcaagacgatccatctgccc
gccgggtccggcggcgcggaggacgcggagacaacggggacaacggggacaacggggacg
gtggagccgacggatgggtga

DBGET integrated database retrieval system