KEGG   Streptomyces clavuligerus: BB341_20925Help
Entry
BB341_20925       CDS       T04717                                 

Definition
(GenBank) glycosidase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
sclf  Streptomyces clavuligerus
Pathway
sclf00500  Starch and sucrose metabolism
sclf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sclf00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BB341_20925
Enzymes [BR:sclf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     BB341_20925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Alpha-amylase_C
Motif
Other DBs
NCBI-ProteinID: ANW20495
LinkDB All DBs
Position
5146103..5147488
Genome map
AA seq 461 aa AA seqDB search
MASRPLAAALALVAGAAAAVMAPAGTAQAAPPGAKDVTAVLFEWKFASVARACTERLGPD
GYGYVQVSPPQEHIQGPQWWTSYQPVSYKIAGRLGNRADFAAMVNTCHGAGVKVVADAVI
NHMAAGDGVGTGGSPYTKYGYPGIYSGFDLDDCRSGIVNYQDRWHVQHCELVGLADLDTG
EEYVRGRIAAYLNDLLSLGVDGFRVDAAKHMPAADLANIKSRLTRPDAYWKQEAIHGEGE
PIAPGEYLGTGDVQEFRYARDLKRVFHGEKLAYLRNYGEGWGYLPSDRAGVFVDNHDTER
LGDTLNYQDGALYTLANVFMLAWPYGAPDVHSGYEWTDKDAGPPNGGRVDACWQDGWKCQ
HAWPEIASMVGFRNAARGEPVTHWWDNGDDRIAFGRGTKAYVAINREAQPLNREFQTGLA
AGVYCDVQSRRSVTVDTAGRFTASLAPNTALALHTAKRSCA
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggccagcagacctctggcagccgcgctcgccctcgtggcgggcgccgcggctgccgtc
atggcgcccgcgggcaccgcgcaggcggccccgccgggagcgaaggacgtcaccgccgtc
ctgttcgagtggaagttcgcctcggtggcgcgtgcctgcaccgagcgcctgggaccggac
ggctacggctatgtccaggtctccccgccccaggagcacatccagggtccccagtggtgg
acctcctaccagcccgtcagctacaagatcgcggggcggctcgggaaccgggccgacttc
gccgcgatggtgaacacctgtcatggggccggggtcaaggtcgtcgccgacgcggtgatc
aaccacatggccgccggggacggggtcggcaccggcggctccccgtacaccaagtacggc
taccccgggatctactccggcttcgacctggacgactgccgcagcggcatcgtcaactac
caggaccgctggcatgtccagcactgcgagctggtcgggctcgccgacctcgacaccggc
gaggagtacgtccgcggccggatcgccgcctatctgaacgatctgctctcgctcggcgtg
gacggcttccgcgtcgacgccgccaaacatatgcccgccgccgacctggcgaacatcaag
tcccggctgacccggcccgatgcctactggaagcaggaagccatccacggcgagggcgag
ccgatagcccccggcgagtacctggggaccggcgatgtccaggagttccggtacgcacgg
gacctcaaacgggtcttccacggcgagaagctggcgtatctgcggaactacggcgagggc
tgggggtatctgccctcggaccgggccggggtcttcgtcgacaaccacgacaccgaacgc
ctgggcgacaccctgaattaccaggacggcgccctctacaccctcgcgaacgtcttcatg
ctggcctggccctacggcgcgcccgatgtccactccggctacgagtggaccgacaaggac
gcgggcccgccgaacggcggccgggtcgacgcctgctggcaggacggctggaagtgccag
cacgcctggccggagatcgcgtccatggtcgggttccgcaacgccgcgcggggcgagccc
gtcacccactggtgggacaacggcgacgaccggatcgcgttcgggcgcggaacaaaggcg
tatgtcgcgatcaaccgcgaggcacagcccctgaaccgggagttccagaccgggctggcc
gccggtgtgtactgcgacgtccagtcgcgccggtccgtcaccgtcgacacggcgggccgc
ttcacggcgagcctcgcgccgaacacggcgctggcgctgcacacggccaaacgttcctgc
gcctga

DBGET integrated database retrieval system