KEGG   Streptomyces clavuligerus: BB341_22715Help
Entry
BB341_22715       CDS       T04717                                 

Definition
(GenBank) fuculose phosphate aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
sclf  Streptomyces clavuligerus
Pathway
sclf00051  Fructose and mannose metabolism
sclf01100  Metabolic pathways
sclf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sclf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BB341_22715
Enzymes [BR:sclf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     BB341_22715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: ANW20822
LinkDB All DBs
Position
5583262..5583924
Genome map
AA seq 220 aa AA seqDB search
MTDYVRQDAIDTTWRAVVDTARRTAAEGLVVGTSGNVSARLGELILVTPSGVPYDRLSPD
DVVGVDLDGRQVLGTLGPTSELPLHLEVYRHTGARAVVHTHAVHATAVSTLVRELPAIHY
MTAALGGPVRVAEYALYGTEELARNLAGALEGRTAALLRNHGTVVYADTLDRAYDHTAQL
EWMCHLWLLASSLPGRTPTLLTSAQLAETASKLSTYGQPG
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgaccgattacgtgcggcaggacgcgatcgacacgacctggcgggccgtggtggacacc
gcccgcaggaccgccgccgagggcctggtggtgggcacatcgggcaatgtctcggcccgg
ctcggcgaactgatcctggtcacccccagcggggtgccctacgaccggctctccccggac
gacgtcgtgggcgtcgacctcgacggacggcaggtgctcggcacgctcggacccacgagt
gagctgccgctccatctggaggtctaccgccacaccggggcgcgcgccgtcgtccacacc
cacgccgtgcacgccacggccgtctccacgctggtgcgggagctgcccgcgatccactac
atgaccgccgcgctcggcgggccggtgcgggtggcggagtacgcgctctacgggacggag
gagctggcgcggaacctggcgggggcgctggaggggcggacggccgcgctgctgaggaat
cacgggacggtcgtgtacgccgacaccctcgaccgggcctacgaccacacggcccagctc
gaatggatgtgccacctctggctcctcgcctcctccctcccgggccgcaccccgacgctc
ctcacctccgcgcagctcgcggagaccgcgtccaaactctcgacatacggccagccgggc
tga

DBGET integrated database retrieval system