KEGG   Streptomyces clavuligerus: BB341_22870Help
Entry
BB341_22870       CDS       T04717                                 

Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
sclf  Streptomyces clavuligerus
Pathway
sclf00061  Fatty acid biosynthesis
sclf00780  Biotin metabolism
sclf01100  Metabolic pathways
sclf01130  Biosynthesis of antibiotics
sclf01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:sclf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BB341_22870
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BB341_22870
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    BB341_22870
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sclf01004]
    BB341_22870
Enzymes [BR:sclf01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     BB341_22870
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     BB341_22870
Lipid biosynthesis proteins [BR:sclf01004]
 Fatty acid synthase
  Component type
   BB341_22870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short PrpR_N Cofac_haem_bdg Oxidored_nitro
Motif
Other DBs
NCBI-ProteinID: ANW20850
LinkDB All DBs
Position
5614402..5615175
Genome map
AA seq 257 aa AA seqDB search
MSGILAGKRILITGVITDASIAFHAAKVAQEEGAEVILTGFGRLSLVERIAKRLPKPAPV
IELDVTNQEHLDTLADRIREHSSDDTGLDGIVHSIAFGPQGAFTFLKAEWEDVSTAVHVS
AYSYKSLATACLPLMEERGGSIVGLTFDAQLAWPKYDWMGVAKAALESTNRYLARDLGPK
GIRCNLISAGPLKSMAAKSIPGFEDLSDVWNHRAPIGWDQSDPEPTGRGVVGLLSDFFPR
TTGEIVHVDGGVHMMGS
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgagcggaatcctcgccggcaagcgcattctgatcacgggcgtcatcaccgacgcgtcc
atcgcgttccacgccgccaaggtggcgcaggaggagggcgccgaggtcatcctcaccggc
ttcggccggctctccctcgtcgagcggatcgccaagcggctgccgaagcccgcgcccgtc
atcgagctggacgtcaccaaccaggagcatctggacacgctcgcggaccgtatccgggag
cactccagcgacgacaccggcctcgacggcatcgtccactcgatcgccttcggcccccag
ggcgccttcaccttcctgaaggcggagtgggaggacgtgtcgaccgcggtgcatgtctcc
gcgtactcgtacaagtcgctcgcgacggcctgtctgccgctgatggaggagcgcggcggc
tcgatcgtcgggctcaccttcgacgcccagctcgcctggccgaagtacgactggatgggc
gtggccaaggccgcgctggagagcaccaaccgctatctggcgcgcgacctcggcccgaag
ggcatccgctgcaacctgatctcggcggggccgctgaagtcgatggccgccaagtccatc
cccggcttcgaggacctgtcggacgtgtggaaccaccgcgccccgatcggctgggaccag
tccgacccggagcccacgggccgcggtgtggtcggcctgctctccgacttcttcccgcgg
acgaccggtgagatcgtccatgtggacggcggcgtccacatgatgggcagctga

DBGET integrated database retrieval system