KEGG   Streptomyces clavuligerus: BB341_23905Help
Entry
BB341_23905       CDS       T04717                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
sclf  Streptomyces clavuligerus
Pathway
sclf00020  Citrate cycle (TCA cycle)
sclf00480  Glutathione metabolism
sclf01100  Metabolic pathways
sclf01110  Biosynthesis of secondary metabolites
sclf01120  Microbial metabolism in diverse environments
sclf01130  Biosynthesis of antibiotics
sclf01200  Carbon metabolism
sclf01210  2-Oxocarboxylic acid metabolism
sclf01230  Biosynthesis of amino acids
Module
sclf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sclf_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:sclf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BB341_23905
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BB341_23905
Enzymes [BR:sclf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BB341_23905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: ANW22080
LinkDB All DBs
Position
5862784..5865003
Genome map
AA seq 739 aa AA seqDB search
MTDSTIIYTHTDEAPALATHSFLPVVEAYASTAGVRVESRDISLAGRIIASFPERLEEGQ
RIADALAELGELAKTPGANIIKLPNISASIPQLKAAVAELQSQGYALPDYPDDPKTDEER
DIRARYDKVKGSAVNPVLREGNSDRRAPASVKNYAKTHPHRMGAWTADSKTNVATMGADD
FRSTEKSVVVAEAGTLRIELVGTDGSTTVLRESVPVLAGEVVDASVLHVASLRTFLADQV
ARAKAEGVLFSVHLKATMMKVSDPIVFGHVVRAFFPKTFAEHGEALAAAGLSPNDGLGGI
LKGLDALADGAAIKASFEAELADGPALAMVDSDRGITNLHVPSDVIVDASMPAMIRTSGH
MWGPDGQEADTLAVIPDSSYAGVYQAVIEDCRAHGAYDPATMGSVPNVGLMAQKAEEYGS
HDKTFEIATAGTVRVVDAEGTVLLEQEVAEGDIFRACQTKDAPIKDWVKLAVSRARATGD
PAVFWLDEGRAHDARLIEKVERYLPEFDSEGLDITILSPVEATKLSVERIRRGENTISVT
GNVLRDYLTDLFPILELGTSAKMLSVVPLMNGGGLFETGAGGSAPKHVQQLVKENYLRWD
SLGEFLALAVSFEHLAQTTGNARAQVLADTLDRATATFLNEDKSPSRRLGGIDNRGSHFY
LALYWAQELARQTDDAQLAHSFSELAATLAEKERTIVDELIAVQGQPVDIGGYFQPDVTK
ASAVMRPSATLNEALAKLG
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
gtgactgactcgaccatcatctatacgcacaccgacgaggcccctgccctggccacgcac
tcgttcctgccggtggtcgaggcatacgcctcgacggccggggtccgggtggagagccgg
gacatctccctcgcgggccggatcatcgcgagcttccccgagcgtctggaggagggccag
cgcatcgccgacgccctcgccgagctgggcgagctggccaagacccccggcgccaacatc
atcaagctgccgaacatctcggcgtccatcccgcagctcaaggcggccgtcgccgagctc
cagtcgcagggctacgcgctgccggactacccggacgacccgaagaccgacgaggagcgc
gacatccgcgcccgttacgacaaggtcaagggcagcgccgtgaacccggtgctgcgcgag
ggcaactccgaccgccgcgcccccgcgtcggtcaagaactacgccaagacccacccgcac
cgcatgggcgcgtggacggccgactcgaagaccaacgtggccaccatgggcgcggacgac
ttccgttccaccgagaagtccgtggtcgtcgccgaggcgggcaccctccggatcgagctg
gtcgggaccgacggcagcaccaccgtgctgcgcgagtcggtaccggtcctcgccggtgag
gtcgtggacgcctccgtgctgcacgtcgcctcgctgcgcaccttcctcgcggaccaggtc
gcccgggccaaggccgagggcgtgctgttctccgtccacctcaaggccaccatgatgaag
gtctccgacccgatcgtcttcggccatgtggtgcgcgccttcttcccgaagaccttcgcc
gagcacggcgaggcgctggccgccgccggtctgagcccgaacgacggcctcggcggcatc
ctcaagggcctggacgcgctcgccgacggcgccgcgatcaaggcgtccttcgaggccgag
ctggccgacggcccggccctcgccatggtcgactccgaccgcggcatcaccaacctgcac
gtcccgagcgatgtcatcgtggacgcctccatgccggccatgatccgcacctcgggccac
atgtggggcccggacggccaggaggccgacaccctcgccgtgatcccggacagcagctac
gccggggtctaccaggccgtcatcgaggactgccgcgcccacggcgcctacgacccggcc
acgatgggctccgtgcccaacgtcggtctgatggcgcagaaggccgaggagtacggcagc
cacgacaagaccttcgagatcgccaccgccggtaccgtgcgcgtcgtcgacgccgagggc
accgtgctgctggagcaggaggtcgccgagggcgacatcttccgcgcctgccagaccaag
gacgccccgatcaaggactgggtgaagctggccgtcagccgcgcccgcgccaccggcgac
ccggcggtgttctggctggacgagggccgcgcccacgacgcccggctgatcgagaaggtc
gagcggtacctgccggagttcgacagcgagggcctggacatcacgatcctctccccggtc
gaggccaccaagctgtccgtcgagcgcatccgccgcggcgagaacaccatctccgtcacc
ggcaacgtcctgcgcgactacctgaccgacctgttcccgatcctggagctgggcaccagc
gccaagatgctgtcggtcgtcccgctgatgaacggcggcggcctgttcgagaccggcgcg
ggcggctccgcgcccaagcacgtccagcagctcgtcaaggagaactacctgcgctgggac
agcctcggtgagttcctggcgctcgcggtcagcttcgagcacctcgcccagaccacgggc
aacgcccgcgcccaggtgctggccgacaccctcgaccgcgccacggcgaccttcctcaac
gaggacaagtcgccgagccgccgcctcggtggcatcgacaaccgcggcagccacttctac
ctcgcgctctactgggcgcaggagctggcgcggcagacggacgacgcccagctcgcccac
tccttctccgagctggccgccacgctggccgagaaggagcggaccatcgtggacgagctg
atcgcggtccaggggcagccggtggacatcggcggctacttccagccggacgtcaccaag
gcgtccgccgtgatgcgcccctcggcgacgctcaacgaggccctggcgaagctcggctga

DBGET integrated database retrieval system