KEGG   Sphingobium cloacae: SCLO_1014530Help
Entry
SCLO_1014530      CDS       T05301                                 

Definition
(GenBank) succinate dehydrogenase and fumarate reductaseiron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
sclo  Sphingobium cloacae
Pathway
sclo00020  Citrate cycle (TCA cycle)
sclo00190  Oxidative phosphorylation
sclo00650  Butanoate metabolism
sclo01100  Metabolic pathways
sclo01110  Biosynthesis of secondary metabolites
sclo01120  Microbial metabolism in diverse environments
sclo01130  Biosynthesis of antibiotics
sclo01200  Carbon metabolism
Module
sclo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sclo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sclo_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sclo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SCLO_1014530
   00650 Butanoate metabolism
    SCLO_1014530
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SCLO_1014530
Enzymes [BR:sclo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SCLO_1014530
    1.3.5.4  fumarate reductase (quinol)
     SCLO_1014530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer2 Fer4_9
Motif
Other DBs
NCBI-ProteinID: BAV64493
UniProt: A0A1E1F1U7
LinkDB All DBs
Position
SCLO_1:complement(1684083..1684871)
Genome map
AA seq 262 aa AA seqDB search
MAEFALPKNSRITGKGVVHRAPDGATNVKSFKVYRYDPDSGENPRYDTFEIDLDNCGPMV
LDALLKIKNEYDSSLTFRRSCREGICGSCSMNMNGKNGLACTTAIDECAGKEVRITPLPH
MDVIKDLVPDFTHFYAQYNSIKPWLQTVSPPPSGKERLQSPKDREKLDGLYECILCACCS
TSCPSYWWNSDKFLGPAILLQAYRWLADSRDEYTGERLDELEDPFRLYRCHTIMNCANVC
PKGLSPAKAIAETKKMMVERQL
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggccgaatttgcgttgcccaagaacagcaggatcactggcaagggcgtagtgcatcgg
gcgccggacggggcgaccaacgtcaagagcttcaaggtctatcgctacgacccggactcg
ggcgagaacccccgctacgacacgttcgagatcgatctcgacaattgcgggccgatggtt
ctggacgcgctgctgaagatcaagaacgaatatgattcgtcgctgaccttccgccggtcc
tgccgcgaaggcatttgcggttcctgctcgatgaacatgaacggcaagaacggtctggcc
tgcaccaccgccatcgacgaatgcgcgggcaaggaagtgcggatcacgccgctgccgcac
atggacgtcatcaaggatctggttcccgacttcacccatttctacgcgcagtataattcg
atcaagccgtggctgcaaaccgtcagccccccgcccagcggcaaggagcggctccagtcg
cccaaggaccgcgagaagctggacggcctttacgaatgcatcctgtgcgcctgctgctcg
accagctgccccagctactggtggaacagcgacaagttcctcggcccggcgatcctgctc
caagcctatcgctggctggccgacagccgcgacgaatataccggggagcgtctggatgaa
ctggaagaccccttccgcctctatcgctgccacaccatcatgaactgcgcgaatgtgtgc
cccaaggggctcagccccgccaaggcgatcgcggagacgaagaagatgatggtcgaaagg
cagctctga

DBGET integrated database retrieval system