KEGG   Sphingobium cloacae: SCLO_1028910Help
Entry
SCLO_1028910      CDS       T05301                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
sclo  Sphingobium cloacae
Brite
KEGG Orthology (KO) [BR:sclo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SCLO_1028910
Enzymes [BR:sclo01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     SCLO_1028910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored HI0933_like AlaDh_PNT_C FAD_binding_3 Glutaredoxin FAD_binding_2 NAD_binding_7 DAO K_oxygenase FMO-like Thi4 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: BAV65931
UniProt: A0A1E1F684
LinkDB All DBs
Position
SCLO_1:complement(3319095..3320681)
Genome map
AA seq 528 aa AA seqDB search
MLDANLKGQLKGYLANITQPIELVASLDDGAKSREMEELLNEIAELSDKVSVARADDDKR
KPSFMIRRVGTDIGVRFAGLPMGHEFTSLVLALLQVGGHPSKAAQDLIQQIRDLDGDFAF
ETYFSLSCQNCPDVVQALNLMSVLNPRISHVAIDGALFQQEVDERKVMAVPTVFLNGEPF
ASGRMELEQIVAKIDSGAADRAAEKIKAQDPFEVLIVGGGPAGAAAAIYAARKGIRTGIA
AERFGGQVLDTMAIENFISVPHTEGPKLAAHLEQHVKEYDVEVMNLQKAAKLIPAKSEGG
YHEVVLENGASLKGRTLILSTGARWRQMGVPGEDEYRNKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVAHVTLIEFDSQLRADAVLQRKLASLPNVKIITSALTTQVQGDG
NKVTGLSYKDRNHGTEHDIELEGIFVQIGLVPNTEWLKDSIALSPRGEIEIDARGETSQP
GVFAAGDCTTVPYKQIVIAMGAGSTAALSAFDYLIRLPASEETAAAAA
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgcaaatctcaaaggacagctcaagggctatctggcgaacatcacccagccg
atcgagctggtggcttcgctggatgacggcgcgaaatcgcgcgagatggaagagctgctg
aacgaaatcgccgaactgtcggacaaggtgtccgtggcccgcgccgacgacgacaagcgc
aagcccagcttcatgatccgccgcgtgggcaccgacatcggcgtacgcttcgcggggctg
cccatggggcatgagttcacctcgctggtgctggcgctgttgcaggtcggcggccatccg
tcgaaggcggcgcaggacctcatccagcagatcagggatctggacggcgatttcgcgttc
gaaacctatttctcgctctcctgccagaactgcccggacgtggtgcaggcgttgaacctc
atgagcgtgctcaacccccgcatcagccatgtcgccatcgacggcgcgctgttccagcag
gaagtcgacgagcgcaaggtgatggcggtgccgaccgtgttcctgaacggagagcctttc
gcttcgggccgcatggaactggaacagatcgtcgcgaagatcgacagcggcgcggccgac
cgcgcggcggagaagatcaaggctcaggaccccttcgaggtgctgatcgtcggcggcggt
ccggccggcgcggcggcggcgatctatgcggcgcgcaagggcatccgcaccggcatcgcg
gcggagcgtttcggcggccaggtactcgacaccatggcgatcgaaaatttcatctccgtc
ccccataccgaagggccgaaactggccgcgcatctggaacagcacgtcaaggaatatgat
gtcgaggtcatgaacctccagaaggccgcgaagctgatcccggccaagtccgaaggcggc
tatcatgaggtcgtgctggaaaatggcgcgtccttgaagggccgcaccctgatcctctcc
accggggcacgctggcggcagatgggcgttccgggcgaggacgaatatcgcaacaagggc
gtggcctattgcccgcattgcgacggtccccttttcaagggcaagcgcgtggcggtgatc
ggcggcggcaatagcggcgtcgaagcggccatcgaccttgccggcatcgtcgcccatgtg
acgctgatcgagttcgacagccagctccgcgccgacgcggtgttgcagcgcaagctcgcc
agcctgcccaatgtgaagatcatcacatcggcgctgacgacgcaggtgcagggcgacggg
aacaaggtgacgggcctcagctacaaggaccgcaaccatggcaccgagcatgacatcgaa
ctggagggcattttcgtccagatcggcctggtcccgaacaccgaatggctgaaggacagc
atcgccctgtccccgcgtggcgagatcgagatcgacgcgcgcggcgaaaccagccagccg
ggcgtgttcgcggcgggggactgcacgacggtgccctataagcagatcgtcatcgccatg
ggcgcgggatcgacggcggcgctgtccgccttcgattacctgatccgcctgcccgccagc
gaggaaacggctgccgctgcggcctga

DBGET integrated database retrieval system