KEGG   Sphingobium cloacae: SCLO_1029380Help
Entry
SCLO_1029380      CDS       T05301                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sclo  Sphingobium cloacae
Pathway
sclo00473  D-Alanine metabolism
sclo00550  Peptidoglycan biosynthesis
sclo01100  Metabolic pathways
sclo01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sclo00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    SCLO_1029380
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SCLO_1029380
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    SCLO_1029380
Enzymes [BR:sclo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SCLO_1029380
Peptidoglycan biosynthesis and degradation proteins [BR:sclo01011]
 Precursor biosynthesis
  Amino acid ligase
   SCLO_1029380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: BAV65978
UniProt: A0A1E1F630
LinkDB All DBs
Position
SCLO_1:3370531..3371487
Genome map
AA seq 318 aa AA seqDB search
MSRGPWHVAVLMGGWSAERSVSLSSGEGVARALESRGHRVTRIDMDRDVALRLAETKPDV
VFNALHGVPGEDGTVQGMMDLMGLTYTHSGLATSVIAIDKQLTKQALVPHGIPMPGGQVV
KSESLFAGDPLPRPYVVKPVNEGSSVGVAIVTQGGNYGSPIGRDVEGPWLHFEELLAEPY
IRGRELTTAVLGEEALLVTELQPKSGFYDFDAKYTDGMTEHVCPADIPDDIAQACKAISL
RAHKLLGCKGASRSDFRWDDTRGIDGLFLLEVNTQPGMTPLSLVPEQAARLGIEYAELVE
RIVEDALKEGPEMGASHG
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgagccggggtccgtggcatgtcgccgtcctgatgggcggctggtcggcggagcggtcc
gtctcgctgtcgagcggggagggtgtcgccagggcgctggaatcgcgcgggcacagggtc
acgcggatcgacatggaccgcgacgtcgcgctacgtttggccgaaacgaagcccgatgtc
gtcttcaatgcgctccatggcgttccgggggaggatggcacggtgcaggggatgatggac
ctgatgggcctcacctacacccattcgggcctcgcgacgtcggtcatcgccatcgacaag
caactgaccaagcaggcgctggtccctcacggcatccccatgcccggcgggcaggtggtg
aagagcgaaagcctgttcgcgggcgacccgctgccgcgtccctatgtggtgaagccggtc
aatgaaggcagttccgtcggcgtcgccatcgtgacgcagggcggcaattatggctcgccc
atcggccgcgatgtcgaagggccttggctgcatttcgaggagctgctggccgaaccctat
attcgcgggcgggaactcaccaccgccgtgctgggcgaggaagcgctgctggtcacggaa
ttgcagcccaagagcggcttctacgacttcgacgccaaatataccgacggcatgaccgag
catgtctgtcccgccgacattcccgacgacatcgcgcaggcgtgcaaggcgatatcgctc
cgcgcccacaagctgctgggctgcaagggggcgtcccgttccgacttccgctgggacgac
acgcggggtatcgacggactgttcctgctggaagtcaacacgcaaccgggcatgacgccg
ctcagcctcgtgcccgaacaggcggccaggctgggcatcgaatatgcggaactggtcgaa
cggatcgtcgaggatgcgctgaaagaggggccggaaatgggggcatcgcatggctga

DBGET integrated database retrieval system