KEGG   Sphingobium cloacae: SCLO_1031020Help
Entry
SCLO_1031020      CDS       T05301                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
sclo  Sphingobium cloacae
Pathway
sclo00020  Citrate cycle (TCA cycle)
sclo00190  Oxidative phosphorylation
sclo00650  Butanoate metabolism
sclo01100  Metabolic pathways
sclo01110  Biosynthesis of secondary metabolites
sclo01120  Microbial metabolism in diverse environments
sclo01130  Biosynthesis of antibiotics
sclo01200  Carbon metabolism
Module
sclo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sclo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sclo_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sclo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SCLO_1031020
   00650 Butanoate metabolism
    SCLO_1031020
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SCLO_1031020
Enzymes [BR:sclo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SCLO_1031020
    1.3.5.4  fumarate reductase (quinol)
     SCLO_1031020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 Thi4
Motif
Other DBs
NCBI-ProteinID: BAV66142
UniProt: A0A1E1F6J7
LinkDB All DBs
Position
SCLO_1:3551874..3553691
Genome map
AA seq 605 aa AA seqDB search
MSTEAYKIIDHTYDTVVVGAGGSGLRATMGSAEAGLKTACITKLFPTRSHTVAAQGGIAA
SLGNNSPDHWTWHMYDTVKGSDWLGDQDAIEYMVREAPAAVIELEHAGVPFSRNENGTIY
QRPFGGHMQNMGEGPPVQRTCAAADRTGHAMLHALYQQSLKYDADFYIEYFAIDLIMEDG
PNGKECRGVIAICMEDGSIHRFRSHAVVLATGGYGRAYFSATSAHSCTGDGGGMVLRAGL
PLQDLEFVQFHPTGIYGAGVLITEGARGEGGYLTNSEGERFMERYAPSAKDLASRDVVSR
SMAMEMREGRGVGPNKDHIYLHLDHIDPKVLAERLPGITESGKIFAGVDLTRQPLPVTPT
VHYNMGGIPCNYHGQVVTKVGDDPEVVVPGLYAVGEAACVSVHGANRLGSNSLIDLVVFG
RATGLHLKETIKPNGSHRPLPKDAADLALGRLDHFRNAKGGSSTAKIRLEMQHTMQKHAA
VFRDSALLSEGVAKMAEVNKRLQDVSIADRSLIWNTDLIETLELDNLMSQAVCTMVGAEN
RKESRGAHAHEDYPNRDDVNWMKHTVSWFEGWGGNGGKVTLDYRPVHDYTLTDEAEYIKP
KARVY
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaccgaagcctacaagatcatcgaccacacctatgacaccgtggtggtgggcgcg
ggcggctccggcctgcgcgcgaccatgggcagcgccgaagcgggcctcaagaccgcctgc
atcaccaagctgttcccaacccggtcgcacaccgtcgccgcgcagggcggcatcgcggcg
tcgctcggcaacaactcgcccgatcactggacctggcatatgtacgacaccgtcaagggg
tccgactggctgggcgatcaggacgcgatcgaatatatggtgcgcgaagcgcccgccgcc
gtgatcgagctggaacatgcgggcgtcccgttcagccgcaatgagaacggcaccatctac
cagcgtcccttcggcggccacatgcagaatatgggcgaaggcccgccggtgcagcgcacc
tgcgccgccgccgaccgtaccggccatgccatgctccacgcgctctaccagcagagcctg
aagtatgacgcggacttctacatcgaatatttcgccatcgacctcatcatggaggacggc
cccaacggcaaggaatgccgcggcgtcatcgccatctgcatggaggacgggtcgatccac
cgcttccgcagccatgcggtcgtgctggcgacgggtggctatggccgcgcctatttctcc
gccacctcggcgcatagctgcaccggcgatggcggcggcatggtgctacgcgcgggcctg
cccttgcaggacctggagttcgtgcagttccacccgaccggcatttacggcgcgggcgtg
ctcatcaccgagggcgcgcgcggcgagggcggctacctcaccaactcggaaggcgagcgt
ttcatggaacgctatgccccttcggcgaaggatctggcctcgcgcgacgtggtgtcgcgc
tccatggcgatggagatgcgcgaaggacgcggcgtgggtccgaacaaggaccatatctac
ctgcacctcgatcacatcgatcccaaggtgctggcggagcgtttgccgggcatcaccgag
agcggcaagattttcgcgggcgtcgacctgacccgccagccgctgcccgtgacgccgacc
gtccactacaatatgggcggcatcccctgtaactatcatggacaggtggtgacgaaggtc
ggcgacgatcccgaagtcgtggtgccgggcctctatgcggtcggcgaagcggcttgcgtg
tcggtccatggcgcgaaccgcctcggctccaactcgctgatcgaccttgtcgtgttcggc
cgcgcgaccggcctgcatctcaaggaaacgatcaagcccaacggatcgcaccgtccgctg
cccaaggatgcggccgatctggcgctggggcgcctcgaccatttccgcaatgccaagggc
ggatcgtcgaccgcgaaaatccgcctcgaaatgcagcacaccatgcagaagcacgccgcc
gtgttccgcgacagcgcgctcctgtcggaaggcgtcgccaagatggcggaggtcaacaag
cggttgcaggacgtgtccatcgccgaccgttcgctgatctggaacaccgacctcattgag
acgctggaactggacaacctgatgagccaggccgtctgcacgatggtcggcgcggaaaac
cgcaaggaaagccgcggcgcccacgcgcatgaggattatccgaaccgcgacgacgtgaac
tggatgaagcacacggtcagctggttcgaaggctggggcggcaatggcggcaaggtgacg
ctcgattaccgtccggtgcacgactacacgctcaccgacgaagcggaatatatcaagccc
aaggcgcgcgtttactga

DBGET integrated database retrieval system