KEGG   Sphingobium cloacae: SCLO_1031040Help
Entry
SCLO_1031040      CDS       T05301                                 

Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
sclo  Sphingobium cloacae
Pathway
sclo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sclo01100  Metabolic pathways
sclo01110  Biosynthesis of secondary metabolites
sclo01130  Biosynthesis of antibiotics
sclo01230  Biosynthesis of amino acids
Module
sclo_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:sclo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SCLO_1031040
Enzymes [BR:sclo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     SCLO_1031040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 Cytidylate_kin2 AAA_33 CoaE AAA_22 AAA_17 AAA_5 AAA_16 dNK AAA Cytidylate_kin MMR_HSR1 ETF TsaE AAA_28 RsgA_GTPase Mg_chelatase AAA_14
Motif
Other DBs
NCBI-ProteinID: BAV66144
UniProt: A0A1E1F6K4
LinkDB All DBs
Position
SCLO_1:complement(3554993..3555541)
Genome map
AA seq 182 aa AA seqDB search
MQRNSKSTAAAAKRGPIVLVGMMGVGKSTVGRRLAARLGLAFVDADEEIEKAAGMTVTDI
FERFGEAHFRDGERRVIARLMDGEPKVIATGGGAFMQPDTRALILDQATAIWLDADIDIL
VDRVSRREGRPLLKGKDPRVVLTELAAVRNPVYALAPIHVKSIAAPHEVAVERILEQLPA
WQ
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgaaacagcaaatccacggcagccgccgcgaagcggggaccgatcgtcctggtc
ggcatgatgggcgtcggcaaatccaccgtcgggcgtcggctcgcggcgcgcctcggcctc
gccttcgtcgatgcggatgaagagatcgaaaaggcggcgggcatgaccgtcacggatatt
ttcgaacgcttcggcgaagcgcatttccgcgatggggaacgccgcgtgatcgcgcgcctg
atggacggcgaaccgaaggtgatcgcgacgggcggcggcgctttcatgcagcccgacacg
cgcgccctgatcctggatcaggcgaccgccatatggctggacgcggacatcgacatattg
gtcgaccgcgtatcccgccgtgaaggacgccccctgctgaaaggcaaggacccgcgcgtg
gtgctgaccgaactggcggccgtccgcaaccccgtctacgcgctcgcccccattcatgtg
aaaagcatcgccgcgccgcatgaagtcgcggtcgagcggattttggagcaactcccggca
tggcaatag

DBGET integrated database retrieval system