KEGG   Sphingobium cloacae: SCLO_2002930Help
Entry
SCLO_2002930      CDS       T05301                                 

Definition
(GenBank) DNA ligase D
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
sclo  Sphingobium cloacae
Pathway
sclo03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:sclo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    SCLO_2002930
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sclo03400]
    SCLO_2002930
Enzymes [BR:sclo01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     SCLO_2002930
DNA repair and recombination proteins [BR:sclo03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     SCLO_2002930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_C DNA_ligase_A_M DNA_primase_S DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: BAV66626
UniProt: A0A1E1F7Y1
LinkDB All DBs
Position
pSCLO_2:complement(325892..327766)
Genome map
AA seq 624 aa AA seqDB search
MARAASRASSEHNTSLPRAGAAAPPPFRAVQLAQLVDTVPSGDRWLHEMKYDGYRTLIAV
GGGEGRAYTRSGLDWSDRFAGIVTDALKLKVGSALIDGEAVVLDVDGRSSFQALQGALKG
APATIDYFAFDLLELDGEDLTGLPLVERKAKLQKILPKSKSRLRYSDHIVGSGEKLLNQF
CAAGLEGVISKLATGKYVGSRSGGWLKTKCIKRQEFVVVGWTPSDKSRLFRSLILAIHEK
GELRYAGKVGTGFDTAELIRLMEIMKPIEQSAPTVKAPRAEVRGAHWLKPKLVAEIAYTE
MTNEGTLRHPSYLGLREDKKPEAVVLETAAPVETVTAPSSVKISNPERIIDPDSGITKGA
LADHYAAVAAIMLPWVGSRPISLVRCPQGRAKKCFFQKHDAGSFGDAVKHVGIMEKDGHE
EPYLYIDTPDGLLTCVQMGTIEFHGWGARIEDVEKADRLVFDLDPDEGLDFEAVRKAAFH
FREILQSIGLKTFPMVTGGKGIHVIAPLVPRAEWPEVKSFAHRLAQAVAQSDPDNFTAAL
PKAQRKGRIFVDYLRNQHGATAVMPYSVRARSGAPVAAPISWKEMETIDTPAHWRVGDAK
ELVKRAASKALAGWGRADQTLPDL
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atggcccgggctgcttcccgcgcaagtagcgagcacaatacgtctctcccgcgcgccggg
gcagcggcacccccaccctttcgggctgtccagctcgcacagctcgtcgataccgtgccg
agcggcgaccgctggctccacgagatgaaatatgacggctaccggacgctgatcgcggtc
ggcggcggcgaaggccgtgcctacacccgctccggtctcgactggtcggatcgcttcgcc
ggcatcgttaccgacgctctcaagctcaaggtcggttctgcgctgatcgacggcgaagcg
gtggtgctcgatgtcgacgggcgatcgagctttcaggcgctacagggcgcgctcaagggc
gcgccggccacgatcgactatttcgcgttcgacctgctggagctcgacggcgaggatttg
accggcctgccgctcgtcgagcgaaaggcgaagctccagaagatcctgccaaagagcaag
agccggctgcgctactccgatcatatcgtgggcagcggcgagaagctcctcaaccagttc
tgcgccgccgggctcgaaggcgtgatctcgaagctcgcgaccggcaaatatgtcggctcg
cgctcgggtggatggctcaagaccaagtgcatcaagcgacaggagttcgtcgtcgtcggc
tggacaccgtcggacaagtcgcggctgttccgctcgctgatcctcgccatccacgagaaa
ggcgagctgcgttacgccggcaaggtcggcaccggcttcgacaccgccgagctgatccgg
ctcatggagatcatgaagccgatcgagcagtcggcgcccaccgtgaaagcgccccgtgcc
gaagttcgcggcgcgcattggctcaagcccaagctggtcgccgagatcgcctataccgag
atgaccaatgaaggcacgcttcgccatccgagctatctcggcctgcgcgaggacaagaag
cccgaggcggtggtgctggagaccgcggcgccagtcgagaccgtgacggcgccatcgtcg
gtaaagatcagcaacccggagcggatcatcgatccggacagcggtatcaccaagggcgcg
ctcgccgaccactatgccgccgtcgccgcgatcatgctgccatgggtcggatcgcggccg
atcagcctagtgcgttgtccgcagggccgcgccaagaagtgcttcttccagaagcacgac
gccggcagcttcggcgatgccgtcaagcatgtcggcatcatggagaaggacggacacgaa
gaaccctatctctacatcgacaccccggacggcctgctgacttgcgtccagatgggcacg
atcgagttccacggctggggagcgcgcatcgaggatgtcgagaaagccgaccggctggtg
ttcgatctcgaccctgacgaagggctcgacttcgaggccgtgcgcaaggccgccttccac
tttcgcgagatcctccagtcgatcggactcaaaactttcccgatggtcaccggcggcaag
ggcatccacgtcatcgcgccgctggtaccgcgtgccgagtggcccgaggtgaagagcttc
gcgcaccgcctggcccaggcggtcgcgcagagcgaccccgacaacttcaccgccgccttg
cccaaggcgcagcgcaagggccgcatcttcgtcgattatctgcgcaaccagcacggcgcg
actgccgtcatgccctatagcgtgcgggcacgatcgggcgcgccggtcgcagcgccgatc
tcatggaaggagatggagacgatcgacacgcccgcacactggcgtgtcggtgatgccaag
gaactggtgaagcgcgccgcgtcgaaggcgctcgccggctggggccgcgccgatcagacc
ctccccgacctgtga

DBGET integrated database retrieval system