KEGG   Schizophyllum commune: SCHCODRAFT_12871Help
Entry
SCHCODRAFT_12871  CDS       T01331                                 

Definition
(RefSeq) hypothetical protein
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
scm  Schizophyllum commune
Pathway
scm00562  Inositol phosphate metabolism
scm01100  Metabolic pathways
scm04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:scm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    SCHCODRAFT_12871
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    SCHCODRAFT_12871
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:scm01009]
    SCHCODRAFT_12871
Enzymes [BR:scm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     SCHCODRAFT_12871
    3.1.3.48  protein-tyrosine-phosphatase
     SCHCODRAFT_12871
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     SCHCODRAFT_12871
Protein phosphatases and associated proteins [BR:scm01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    SCHCODRAFT_12871
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc PTPlike_phytase Y_phosphatase3 Y_phosphatase
Motif
Other DBs
NCBI-GeneID: 9597860
NCBI-ProteinID: XP_003038100
UniProt: D8PS21
LinkDB All DBs
Position
Unknown
AA seq 562 aa AA seqDB search
MTDYVRRLVSGNKARFKDKKLDVELDLVYLTDQVIIMGYPASGVEGWYRNPREDVKKFLE
HRHGKNYWIFNFCPLRENSYDASYFDNRVSRFPFPDHHAPPLAILPLVAREIHAWLDGSK
ERVAVLHCKAGKGRSGTMACAYLLTLHKEPSAPELERSYTAKQWAKLRADDTMKVVPDDV
DSDNEEAKAVTESELATPSEVKDWSSSGASSISSATPNGNEKASTDKPTDSSAPPKSFTD
SLKGVLDLHTARRMKPAESGKKVKQGVSIPSQRRWLYYWALLLSNEAPKHLWPPLGAPAA
PPPRVRLTEVRVRMTEETGVKLTVARAANALLDRAGVGSAAKNGTSSCVWASLARYDDDF
VKTLEDWERHTRGNTIGERRAGSDHLGDDELRSIFADGKWDKGKMVRSFARMGILGEDAI
TKSGEGKEERVTTYALRPLTAASWGEVLQGLKDGGDGKDADATAARADIPRSEANSMLDV
TADARERGIVVDAGREVRVKLYMGQIFMGWCWFIPTFHMPQPPPGAGTPPDATPSRATMH
LSWTFRLALGSIWLMWILRWNG
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgaccgactacgtacgccgacttgtatcaggaaacaaggctcgtttcaaggacaagaag
ctcgatgtagagcttgatcttgtatacctgacggaccaggtgatcatcatgggctaccct
gcatctggtgtcgagggatggtaccgtaatccacgagaagacgtgaagaagtttcttgaa
catcgtcatgggaagaactactggatattcaacttctgcccccttcgcgagaattcatac
gacgcgtcgtactttgacaatcgtgtcagccggttccccttccccgaccatcacgcgcca
ccgttagccattcttcccctcgtagcccgagagatacacgcttggctggatgggtcgaaa
gagagggttgctgtgttgcattgcaaagctggcaagggacgttcgggcacgatggcatgc
gcatacctcctcaccctgcataaggagccttcagcacccgagctcgaacgcagctacacc
gcgaagcagtgggccaagctgcgcgccgacgacaccatgaaggtcgtgccagacgatgtc
gacagcgacaacgaagaagcaaaggcagtcactgaatcagagctcgctactccttcggag
gtcaaggattggtcgagcagcggtgcatcctctatatcttcagcgactccgaacggcaac
gagaaggcaagcacggataagcctacagattccagcgcgccgccaaagtccttcaccgac
tcgctgaagggtgtacttgacttgcacaccgcgcgacgcatgaagcccgctgagtcgggc
aagaaggtcaagcagggtgtcagcatcccgtcgcagcggcgctggctctactattgggcg
ctccttttgtcgaatgaggcgcccaagcacctatggcctccgctcggcgcacccgctgcg
ccgccgcctcgcgtacgcttgacggaggtccgtgttcggatgaccgaggagaccggcgtc
aagctcaccgtcgcacgcgctgcgaatgcgctgcttgaccgcgctggcgtcggctctgcc
gccaagaacgggacgagcagctgcgtctgggcatcactcgcgcgctacgacgatgacttc
gtgaagacgctcgaggactgggagcggcatacacgaggtaataccatcggcgagcgacga
gcggggtcggaccatctgggcgacgatgagcttcgctcaatttttgcggatgggaagtgg
gacaagggcaagatggtgcgcagcttcgcgcggatgggtatcctgggcgaggacgcgatc
accaaatcgggcgaagggaaagaggagcgggtaacgacctatgccctccgtcctctgacc
gccgcatcctggggcgaggtccttcagggcttgaaagacggcggcgacggcaaggacgcc
gacgccacggctgcccgcgccgacatccctcgttccgaagccaactccatgcttgacgtt
accgccgatgcccgcgagcgcggcatcgtcgtcgacgccgggcgcgaagtccgcgtcaag
ctctacatgggccagatcttcatgggctggtgctggttcatccccaccttccacatgccg
cagccgccgccaggggcggggaccccgccggacgcgacgccgagcagggcgacgatgcac
ctgagctggactttccgattggcattggggagcatttggttgatgtggatattgagatgg
aatggctga

DBGET integrated database retrieval system