KEGG   Schizophyllum commune: SCHCODRAFT_235431Help
Entry
SCHCODRAFT_235431 CDS       T01331                                 

Definition
(RefSeq) glycoside hydrolase family 13 protein
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
scm  Schizophyllum commune
Pathway
scm00500  Starch and sucrose metabolism
scm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SCHCODRAFT_235431
Enzymes [BR:scm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     SCHCODRAFT_235431
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase DUF1966 Cellulase
Motif
Other DBs
NCBI-GeneID: 9586700
NCBI-ProteinID: XP_003030953
JGI: Schco1_235431
UniProt: D8Q7N0
LinkDB All DBs
Position
Unknown
AA seq 490 aa AA seqDB search
MFSKSLLLSLPLISGAFAATAEDWRKRSIYELVTDRFARTDGSTTAPCNTGDRVFCGGTW
QGLTNHLDYIKNMGFTAVWISPITMQIYGNTHSGEAYHGYWPKDYYQLNPNFGTADDLRN
LAKALHDRGMYLMVDLVVNHYASWGDEDIQWSQYVPFNDQKYFHDKCWINWNNQQSIEDC
WMGDGYVPLPDLDTENDYVVSTLEKYVGELVSNYSIDGLRLDATKNIRKDFWPGFCSAAG
VYCQGEVWTADVNQFCPWQDYMAGLHNYPMHDYTVSAFSWHKGDVNALANTLNALTNQCA
DVGLLGSFTENHDNPRMGSVTNDLSQRKSLAAMTILSGNGIPIVYYGQEQIFDAKKDPDN
REALWLSGYATGGDKLYDYFAQLNGLRNWLVWNIPEGDYLTAKPSYSVYDTHTLVASKGV
TKVLVSNMGASVDGSVATSGWSAGEDVVDALSCNTYTADSQGKATISMKLSLPAAVLPKS
SLGGSGICGL
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgttctccaagtcactccttctttccctcccactcatttctggcgcgtttgccgcgact
gccgaggactggcgtaagcgctcgatttacgagctcgtgaccgaccgcttcgcgcgcacg
gatggcagcactaccgcgccgtgcaacacgggcgaccgtgttttctgcggcgggacgtgg
caggggctgaccaaccaccttgactacatcaagaatatgggattcacggccgtatggatc
agccctattacgatgcagatttacgggaacacgcactcgggcgaggcttaccatggttac
tggccgaaggactactatcagctgaacccgaacttcggtacggcggacgacctgaggaac
cttgcgaaggccctgcacgaccgcggcatgtacctcatggtcgacctcgtcgtaaaccac
tacgccagctggggcgacgaggacatccaatggtcgcaatacgtccccttcaacgaccaa
aagtacttccacgacaagtgctggatcaactggaacaaccagcagtctattgaggattgc
tggatgggtgacggctacgtgccccttccggacttggacacggagaatgactacgtcgtc
tcgaccctcgagaaatacgtcggcgagctcgtctcgaactactcaatcgacggcctccgc
ctcgacgcgacgaagaacatccgcaaggacttctggcccggcttctgtagcgctgcaggc
gtgtactgccagggagaggtctggacggccgacgtcaatcaattctgcccatggcaagat
tacatggccggtcttcacaactacccgatgcatgactacactgtcagcgccttcagttgg
cacaagggtgacgtgaacgcactagccaacacgctgaacgcgcttaccaaccagtgcgct
gatgtcggtctcctcgggtccttcaccgagaaccacgacaaccctcgcatgggcagcgtg
accaacgacctgtctcagcggaagtcgctcgccgctatgaccatcctttccggcaacggt
atccccatcgtctactacggccaggagcagatcttcgacgcaaagaaagacccggacaac
cgcgaggcgctctggctctccggctacgcgaccggcggcgacaagctctacgactacttc
gcgcagctcaacggcctccgcaactggctcgtgtggaacatccccgagggcgactacctc
accgcgaagccgtcctactccgtgtacgacacgcacacgctcgtcgcgtccaagggcgtc
acgaaggtgctcgtgagcaacatgggcgccagcgtcgacggcagcgtcgcgacgtcgggc
tggtcggcgggcgaggacgtcgtcgatgcgctgagctgcaacacctacactgcggactcg
cagggcaaggcgacgatttcaatgaagttgtccctgccggcggcggtcctgcccaagtcc
tccctcggcggctctggcatctgtggtctgtaa

DBGET integrated database retrieval system