KEGG   Schizophyllum commune: SCHCODRAFT_29029Help
Entry
SCHCODRAFT_29029  CDS       T01331                                 

Definition
(RefSeq) hypothetical protein
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
scm  Schizophyllum commune
Pathway
scm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
scm01100  Metabolic pathways
scm01110  Biosynthesis of secondary metabolites
scm01130  Biosynthesis of antibiotics
scm01230  Biosynthesis of amino acids
Module
scm_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:scm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SCHCODRAFT_29029
Enzymes [BR:scm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     SCHCODRAFT_29029
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAHP_synth_1 DUF2313
Motif
Other DBs
NCBI-GeneID: 9591939
NCBI-ProteinID: XP_003028466
UniProt: D8QGB0
LinkDB All DBs
Position
Unknown
AA seq 268 aa AA seqDB search
GLATARALLCAITDLGVPVGAELLDTVSPQFLSDLTSWAAIGARTTESQLHRELASGCSF
PVGFKNGTDGGVTVAIDAMHSASHPHAFMGVTPQGLASIVKTTGNPHLHVILRGGTGGPN
YGAEDIRRVVGEIRRRSEREKDGSGGGGGKERFASVMVDCSHGNSQKDYRNQPKVLHSLC
QTIAGEGLSANGEVEDTLDIAPHITGVMIESNINEGRQDVPVGNVRAHLKPGVSITDGCV
SWETTVGMLDELNAAVAKRRERLAARRG
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
ggcctcgccaccgcgcgcgcgctcctgtgcgcgatcacggacctcggcgtccccgtcggc
gcggagctgctcgacacggtcagcccgcagtttttgagcgatttaacctcctgggccgcg
atcggcgcgcgcacgacggagagccagctgcaccgggagctcgcgagcgggtgctcgttc
ccggtcgggttcaagaacgggacggatgggggcgtcaccgtcgcgatcgacgcgatgcac
tccgcgtcgcacccgcacgcgttcatgggcgtgacgccgcagggcctcgcctccatcgtc
aaaacgaccggcaacccgcacctgcacgtcatcctccgcggcggcacgggcgggccgaac
tatggggcggaggatatcaggcgggtggtgggggagattaggaggaggagcgagagggag
aaggacgggagtgggggtgggggtgggaaagagaggtttgcgagcgtgatggtggattgc
agccacggcaactcgcaaaaggattaccgcaaccagccgaaggtgctccactcgctgtgc
cagacgatcgcgggcgaggggttgtcggcgaatggggaggttgaagacacgctcgacatc
gccccgcacatcacgggcgtcatgatcgagagcaacatcaacgagggccggcaggacgtg
ccggtggggaacgtccgcgcgcacctcaagcccggcgtgtcgatcaccgacgggtgcgtg
tcgtgggagacgacggtggggatgctggacgagctgaacgcggcggtggcgaagaggcgg
gagcggctggcggcgaggaggggg

DBGET integrated database retrieval system