KEGG   Schizophyllum commune: SCHCODRAFT_47464Help
Entry
SCHCODRAFT_47464  CDS       T01331                                 

Definition
(RefSeq) hypothetical protein
Organism
scm  Schizophyllum commune
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 DPBB_1 Sperm_Ag_HE2 GST_C
Motif
Other DBs
NCBI-GeneID: 9595102
NCBI-ProteinID: XP_003036420
JGI: Schco1_47464
UniProt: D8PNF1
LinkDB All DBs
Position
Unknown
AA seq 276 aa AA seqDB search
MSATTDSGKTYRTECTGAAHETVKRHSSDEAITLFAACFCPFVQRAWIALEYLGVPYKVD
EVDPYKKPQALLEVSPKGLVPGLKLHNYNPPRALNESTVILEYLEDVASNTTKRSLLPPR
TNPYARALVRLQADHVNRTLVPAFYRYLQAQDADAQIKGGQEFLEAIRGLTDLFERMERE
IAGLGLWVEGGDLGYVDAMAGPWIFRASIVLKHYRGFTMPEGEKFTAWTQRLFSHPVFKS
TCSTDDLYLDSYERYAHNRPNTSMVANAINSGRGLP
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccaccaccgacagcggcaaaacataccgcaccgagtgcaccggtgccgcacat
gagaccgtcaagcgacactcgtccgacgaggccataaccttgttcgccgcgtgcttttgc
ccgtttgtgcagagggcgtggatcgcgctggagtatcttggtgtaccgtacaaggtggat
gaagtcgacccgtacaagaagccgcaggcgctgttggaggtgtcgccaaagggcctcgtt
cccggtctgaagctgcacaattacaacccgccgcgggcactcaatgagagcacggtcatc
cttgagtatctggaagacgtcgcgtcaaacacaacgaagcgcagcctccttcctcctcgg
actaacccatacgcccgcgccctcgtccgcctccaagccgaccacgtcaaccgcacgctc
gtccccgccttctatcgctacctccaagcccaggacgccgacgcgcaaatcaaaggcggt
caggaattcctcgaagccatccggggcttaacggatctcttcgagcgcatggagcgcgag
atcgcggggctcggtctctgggttgagggtggggacttggggtacgtggacgcgatggcg
gggccgtggatcttccgcgcgtcgatcgtcttgaagcactaccgcgggttcacgatgccc
gagggcgagaagttcacggcgtggacgcagcgcttgttcagccacccggtgttcaagtcg
acgtgcagcacggatgatttgtacttggatagctacgagagatatgcccacaaccgcccg
aacacaagcatggtagcaaatgccattaacagtggacgcggcctgccttga

DBGET integrated database retrieval system