KEGG   Schizophyllum commune: SCHCODRAFT_53697Help
Entry
SCHCODRAFT_53697  CDS       T01331                                 

Definition
(RefSeq) DNA ligase IV-like protein
  KO
K10777  DNA ligase 4 [EC:6.5.1.1]
Organism
scm  Schizophyllum commune
Pathway
scm03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:scm00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    SCHCODRAFT_53697
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:scm03400]
    SCHCODRAFT_53697
Enzymes [BR:scm01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     SCHCODRAFT_53697
DNA repair and recombination proteins [BR:scm03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     SCHCODRAFT_53697
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N BRCT_2 DNA_ligase_A_C BRCT RNA_ligase LIG3_BRCT Acetyltransf_14
Motif
Other DBs
NCBI-GeneID: 9590663
NCBI-ProteinID: XP_003032648
JGI: Schco1_53697
UniProt: D8Q0I4
LinkDB All DBs
Position
Unknown
AA seq 1065 aa AA seqDB search
MQATPAPTEAPGSPQPSQTTASQQPFPEQPYNTDTLPFHILTAFFEKLQGERKQEKRRKL
LNHWFNKWREDNGPDLYPVLRLILPHRDRERNVYGLKEKALAKLYIKVIPLNKNDPDAMR
LLYWKKPTEKHASTCASSAASGDFPTVLYEVVSKRSSVTQSTLTIDDINDMLDQLADMSN
KSEKQSKIIQRLYNEATPEQQLWFARIILKDMNISVKETTVFAVFHPDAQALYNTCSDLK
KVAWQLADPSIRLHEDEKQVKLGQPFMPMLCKRPMKRIEDTAQEMDGSEFIIEEKLDGER
MQLHKMGNQYYYSSRKGKDYTYLYGSHVGAGSLTPYIAHRFHKQADSAILDGEMLVWDPI
SGRNLPFGTLKTAALDQSKKQAAPRPCLKVFDLLYLNGKSLIDKSTAFRKKNMRLVIEAL
PGRIEFVDEFKGRTAQDIREKMDEVMANRGEGLVIKHPKSQYVLNGRNNDWIKVKPEYMD
NMGETVDVLVVAGNYGSGRRSGGVSTLICAVFDDRNTGSFNENESKYATFVRVGSGLTYA
DYMWLRAKNWKTWDAKNSPTYLQTAKRSHEDKGDVYLEYEDTFILKVKAAEITPSDQYHV
RYTMRFPRALSIREEMAPGDCMTASAVVEQLKTAKKRKMETNKVSSTKKRKVVKKKVEML
PRFDGPDMKDVKEESDLFKGMKFVVISDPKARTGEEDRKKLMKLIRSHGGQCPQFAKDPA
AIVVYNGTSTPYDLQLIIRKDTNDVVRPQWVMDCIAKGELVPMEKKYFFFATTARKETAE
YGEDGGAESSGSVTQESSDDEAAAETSQSSKKRKRAGKSAEPETQDKTADEEKATPAPSK
PKVDLDPGLAAWLGYDEDDAAGVEDDAGEKDERGGRDDVESDNDSDNQDVKDEEEEDDMA
FWFNEDDGDDSATATLPTQKTTQSTADTQKGDDAPTTQPEVKMGDDNAMHYDEELIFKYL
CFYLDSPSNARASGMSVKSTAHEDEINESFEELRSKIESNGGRVVDLSEPKLTHVVLDKR
DLSRRIDLMRRTSKPKRRHLVLTAYIDACLEENTLLDEDGELGHA
NT seq 3198 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcgacccctgcacccacagaagcccctggctctccgcagccttcgcaaacaaca
gcttcgcaacaaccatttcctgagcagccctataacaccgacaccctccccttccatatc
ctcaccgcattctttgagaagctacaaggagagcgtaagcaggagaagcgcaggaagcta
ctcaaccactggttcaacaaatggagagaagacaatggaccagacctgtatcctgtactg
agactgattcttccgcatcgcgaccgagaacgcaatgtgtatggcctgaaagagaaggca
ctcgccaagttatacatcaaggtgatacccttgaataagaacgacccagatgctatgcgg
ctgctgtactggaagaaaccgacagagaagcatgcaagtacttgcgcaagctctgctgca
tctggagactttccgaccgtgctttacgaggtcgtcagcaagcgttcctcggtcactcag
agcaccttgaccatcgacgacataaacgacatgctcgaccagcttgccgacatgtcgaac
aagtcagagaagcagtcgaagatcatccaaagactttacaatgaggcgacacccgagcag
cagctttggtttgcgcgcatcattctcaaggacatgaacatctccgtcaaggagaccacc
gtcttcgccgtcttccaccccgacgcgcaggcgctctacaacacttgctccgacctcaag
aaggtggcatggcagctcgcagatccgagcatccgactccatgaagatgagaagcaagta
aagctcggccagcctttcatgcccatgctctgcaagcggcccatgaagcggattgaggat
acggcgcaggagatggacggctctgagttcatcattgaggagaagctggacggcgagcga
atgcagttgcacaagatggggaaccagtactactactcttcgaggaaaggcaaggactac
acctacctctacggctcgcacgttggcgccggaagtctgaccccttacatcgcgcaccgc
ttccacaagcaggccgactccgccatcctcgacggcgaaatgctcgtctgggaccccatc
tccgggcgcaacctccccttcggcaccctcaaaaccgccgccctcgaccagtccaaaaag
caagccgcgccccgcccctgcctcaaagtcttcgacctcctgtacctcaacggaaagtcc
ctcatcgacaagtccaccgccttccgcaagaagaacatgcgcctggtcatcgaggcgctg
cccgggcggatcgagttcgtcgacgagttcaaggggcggacggcgcaggacatacgggag
aagatggacgaggtgatggcgaatcggggggaggggctggtgattaagcacccgaagtcg
cagtatgtgctgaatgggaggaataatgattggattaaggtgaagccggagtatatggac
aacatgggcgagaccgtggacgtgctcgtcgtcgccggcaactacgggtctggcagacgg
tccggcggcgtctcgaccctcatctgcgccgtcttcgacgaccggaatacaggcagcttc
aacgagaatgaatccaagtacgccacctttgtccgcgtcgggtctggcctaacgtacgcc
gactacatgtggctgcgcgcgaaaaactggaagacgtgggacgccaagaactcgccgacg
tacttgcagacagcgaagcggtcgcatgaagacaagggggatgtgtatttggagtacgag
gacacgttcatcctgaaggtcaaggcagcggaaatcacgccgtctgaccagtaccatgtc
cgctacacgatgcgctttcctcgcgcgctgtccatccgggaggagatggctccgggggac
tgcatgacggcgagtgccgtcgtcgagcagctgaagaccgcgaaaaagcgcaagatggag
acgaataaggtctcgtccacgaagaaacgcaaggtcgtgaagaagaaggtggagatgctc
ccgcgcttcgacggaccggatatgaaggacgtgaaggaggagagcgatttgttcaaggga
atgaagtttgtcgtcatctccgacccgaaggcaaggacgggcgaggaggacaggaagaag
ttgatgaagctcatccgctcgcatgggggacagtgcccgcagttcgcgaaggacccggct
gcaattgtggtgtacaatgggacgtcgacgccctacgacctccaactcatcatccggaag
gacacgaatgacgtggtgcgccctcagtgggtgatggactgtatcgcaaagggcgagttg
gtgccgatggagaagaaatatttcttcttcgccaccacagcgcgcaaagagaccgccgag
tacggcgaggatggcggtgctgaatcgagcggcagcgtgacgcaggagtcgtcggatgat
gaggccgccgcggagacgtcgcagagcagcaagaagcgcaagcgagctggcaagtcggcg
gaaccggaaacgcaggacaagaccgccgacgaggagaaggccacacctgcaccctcgaag
cccaaggtcgacctggacccggggcttgcggcgtggctgggctatgacgaggacgacgcg
gcgggagtggaggacgatgcaggggagaaagacgagcgcggtggccgagacgacgtcgag
tccgacaacgactcggacaatcaagatgtcaaggacgaagaggaagaggatgacatggcc
ttctggttcaacgaggacgacggagatgactctgccacggccacgcttcccacgcaaaag
accacacaatcgaccgccgacacgcagaagggggatgacgcccccacgacgcaaccggaa
gtgaagatgggcgacgacaacgcgatgcattacgacgaggagctcatattcaagtaccta
tgcttctacctcgactcgccctccaacgcacgcgcatccggcatgtccgttaaatcgacc
gcacatgaggatgagatcaacgagagctttgaagagctgagatcgaagatcgagagcaac
ggaggccgagtggtcgacctgagcgagccgaagttgacgcatgtcgtgctggataagcgg
gatttgagcaggaggatagatctcatgaggcgcacgtcgaagccgaaacgccggcatctc
gtgttaaccgcgtatatcgacgcgtgtctggaggagaacacgctactggacgaagatggt
gagctagggcacgcataa

DBGET integrated database retrieval system