KEGG   Schizophyllum commune: SCHCODRAFT_57589Help
Entry
SCHCODRAFT_57589  CDS       T01331                                 

Definition
(RefSeq) glycoside hydrolase family 15 and carbohydrate-binding module family 20
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
scm  Schizophyllum commune
Pathway
scm00500  Starch and sucrose metabolism
scm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SCHCODRAFT_57589
Enzymes [BR:scm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     SCHCODRAFT_57589
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15 CBM_20 AMPK1_CBM
Motif
Other DBs
NCBI-GeneID: 9591574
NCBI-ProteinID: XP_003030591
JGI: Schco1_57589
UniProt: D8Q9M3
LinkDB All DBs
Position
Unknown
AA seq 576 aa AA seqDB search
MGLASTVSLALLGLCSLARAQTSAADAYVSAESPIAQAGILANIGPSGSKSHGAASGVII
ASPSTSNPDYLYTWTRDAALVSRALVDEFIEGESSLQSVIDSYVSSQQKLQRVDNPSGSY
TSGGLGEPKFNIDLTAFTGAWGRPQRDGPALRAITLITYGNHLLSSGNTSYVTDTIWPVV
KADLDYVVSYWNQTGFDLWEEVSSSSFFTTAEQHTALRLGATFATAVGASASTYLTQADN
VLCFLQSYWNSNGGYATANTGGGRSGIDANTVLTSIHTFDIEAGCDSVTFQPCSDRALSN
LKVYVDSFRGLYSINPTGATDPILTGRYKEDVYYNGNPWYLTTFAVAEQLYDALNTWDKL
GSLDVTSTSLAFFKQFDSSITAGTYASSTSEYATLTSAIRNWADGFLEVLADFTPADGGL
TEQIDKSSGNPTSAADLTWSYASAITAFKARGGAIPASWGAAGLTVPATCSTGGGGGSGG
DTVAVTLNVQATTVYGENIYVTGSVNQLANWSPDNAIALNADNYPTWSVTVNLPANTQIE
YKYIRKNNGQVTWESDPNRSITTSASGSFTQNDTWR
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgggtctcgcttccactgtctcgctcgccctcctcggcctctgctcgctcgcccgtgct
cagacgagcgcggcggacgcgtatgtttcggcggagtcgcctattgcgcaggcgggcatc
ttggccaacatcggccccagcggctcgaagtctcacggtgctgcctccggtgtcatcatc
gcatccccctcgacgtcgaacccggattacctgtacacctggacgcgcgacgctgctctc
gtttctcgcgctctcgtcgatgagttcatcgagggcgagtcgagcctgcagtcggtcatc
gactcgtatgtcagctcgcagcagaagctgcagcgcgtcgacaacccctctggctcgtac
accagcggcggcctcggcgagcccaagttcaacatcgacctgactgccttcactggcgct
tggggacgccctcagcgcgatggcccggctctgcgtgctatcaccctcatcacctacggg
aatcatctgcttagctccggcaacacctcatacgtcacggacactatctggccagtcgtg
aaggctgacctggactacgtcgtctcgtactggaaccagactggcttcgacctctgggaa
gaggtcagctcctcgtcgttcttcacgactgccgagcagcacaccgccctccgcctcggt
gccaccttcgccaccgccgtcggcgcctccgcgtccacctacttgacgcaggccgacaac
gtgctctgcttcctgcagtcgtactggaacagcaacggcggctatgcgacggccaacacc
ggcggcggccgctctggcatcgacgccaacacggtcctcactagcattcacaccttcgac
atcgaagccggctgcgactcggtcaccttccagccctgctctgaccgcgcgctgtctaat
ctgaaggtttacgtcgactcgttccgcgggctttactccatcaaccccaccggtgccacc
gaccctatcctcaccggccgctacaaggaggacgtgtactacaatggaaatccttggtac
ctcaccaccttcgccgtcgccgagcagctctacgacgcgctcaatacctgggacaagctc
ggctcgctcgacgtcaccagcacctccctcgccttcttcaagcagttcgactcctccatc
accgccggcacctacgcgtcctccacctccgagtatgccaccctcacctctgcgatccgc
aactgggccgacggcttcctcgaggttctcgccgacttcacgcctgcggacggcggcctg
acggagcagatcgacaagtcgagtgggaatcccacttcggcagcggacctcacctggagc
tacgcgtccgccatcaccgcgttcaaggcccgcggcggggcgattccggcaagctggggc
gcggcgggcctcactgtgcccgcgacgtgcagcacgggcgggggcgggggcagcggcggt
gacacggtcgctgtcacgctcaacgtccaggctaccactgtctacggcgagaacatctac
gtgaccggcagcgtcaaccagctcgccaactggtccccggataacgccatcgcgctcaat
gctgacaactacccgacctggagtgtgaccgtcaacctgcccgccaacacccagatcgag
tacaagtacatccgcaagaacaacgggcaggttacgtgggagtccgaccccaacaggagc
atcactacctccgcgtcgggctccttcactcagaatgacacctggcgctaa

DBGET integrated database retrieval system