KEGG   Schizophyllum commune: SCHCODRAFT_58306Help
Entry
SCHCODRAFT_58306  CDS       T01331                                 

Definition
(RefSeq) glycoside hydrolase family 15 protein
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
scm  Schizophyllum commune
Pathway
scm00500  Starch and sucrose metabolism
scm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SCHCODRAFT_58306
Enzymes [BR:scm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     SCHCODRAFT_58306
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15
Motif
Other DBs
NCBI-GeneID: 9594270
NCBI-ProteinID: XP_003029520
JGI: Schco1_58306
UniProt: D8QD00
LinkDB All DBs
Position
Unknown
AA seq 470 aa AA seqDB search
MAFTITASLVAIGLAAFAKAQSSTVEAYISSESPIAQAGILAAIGPDGENSGGAAAGVIV
ASPSDSDPDYLYTWTRDAALVSRVLVDQFTQGGDSSLQSVIESYVSAQDTLQHLDNPSGG
YDSGGLGEPKFNIDLTAFTDAWGRPQTDGPALRALTLITYGNSLQSGDNSSYVTDTLWPI
IKADLDYVVQYWNQQTFDLWEEVQSSGSFFTTVVQHAALRQGVSFASAVGDDGPSYSSAA
DSVLCTAQSFWNEDGGYFNANQGGGRSGIDNNAVLASIHTFDVEAGCDSNTFQPCSDRAL
SNLKVYVDSFRGLYSINPTGDTDAILTGRYKEDSYQGGNPWYLNTFAVAEQLYDALTTWD
QVGSIDVTSTSLAFFQQFSDSIAEGSYDSSSDEYSTLTSAIHDWADGFIEIIANYTPSDG
SLAEQIKKDSGEPASALDLTWSYASAVTAFNARDGFVPASWGAANVTASC
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggctttcaccatcaccgcttccctcgtcgccatcggcctcgctgccttcgctaaggcg
cagtccagcactgttgaggcgtacatctcttcggagtcgcccatcgcgcaggctggcatt
ttggcggccattggccccgacggcgagaactctggcggtgctgctgctggcgtcattgtc
gcctctccctccgattcggaccccgactacctgtacacctggacgcgcgacgccgcgttg
gtctcgcgggtcctcgttgaccagttcactcagggcggcgactcgagcttgcagagcgtc
atcgagtcgtatgtgtctgctcaggacaccctccagcacctcgacaacccctccggtggc
tacgactctggagggctcggcgagcccaagttcaacattgacctgacggccttcacggac
gcttgggggcgccctcagactgatggtcccgcgctccgcgctcttacgctcatcacgtac
ggtaactctctacagagcggtgacaactcgtcctatgttacggacaccctctggccgatc
atcaaggccgacctggactacgtcgtccagtactggaaccagcagaccttcgatctgtgg
gaggaggtccagtcctcgggctcgttcttcacgaccgtcgtccagcacgccgcgctccgc
cagggcgtcagcttcgcgagcgctgttggggacgatggcccgtcctacagctccgcggcc
gatagcgtcctatgcaccgcgcagtcgttctggaacgaggacggcggctactttaatgcg
aaccagggcggcggccgctccggcatcgataacaacgccgtgctcgcgagcatccacacc
ttcgacgtcgaggcgggctgcgattcgaacaccttccagccgtgctctgaccgcgcgctg
tccaacctgaaggtgtacgtcgactcgtttcgcggtctctacagcatcaacccgaccggc
gacacggacgctatcctcactggccgctacaaggaggactcgtaccagggcggcaacccc
tggtacctcaacaccttcgccgtcgccgagcagctctatgacgcgctcacgacctgggac
caggtcggctcgatcgacgtcacgtccacctcgctcgccttcttccagcagttctccgac
tccatcgccgagggctcgtacgactcgagctcggacgagtacagcacgctcacgtcggcg
atccacgactgggcggacggcttcatcgagatcatcgcgaactacacgccgagcgacggc
tcgctcgcggagcagatcaagaaggacagcggcgagccggcgagcgcgctggacctgact
tggagctatgcgtcggcagtcacggcgttcaacgcgcgcgatgggttcgtgcctgccagc
tggggcgccgccaatgtgactgccagctgttaa

DBGET integrated database retrieval system