KEGG   Schizophyllum commune: SCHCODRAFT_66348Help
Entry
SCHCODRAFT_66348  CDS       T01331                                 

Definition
(RefSeq) glycoside hydrolase family 31 protein
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
scm  Schizophyllum commune
Pathway
scm00052  Galactose metabolism
scm00500  Starch and sucrose metabolism
scm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    SCHCODRAFT_66348
   00500 Starch and sucrose metabolism
    SCHCODRAFT_66348
Enzymes [BR:scm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     SCHCODRAFT_66348
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 9594935
NCBI-ProteinID: XP_003036330
JGI: Schco1_66348
UniProt: D8PUK9
LinkDB All DBs
Position
Unknown
AA seq 904 aa AA seqDB search
MKSALIAATLAVAPALTMYVDPAKLDACAGYDASNVYSDGTKLTATLNVAGDCGVFGEDI
SELALEVTYETTTRLHVKISDAAHPRYEVPDVVVPRPTIGEGASQDNSEIQFNYTESPFS
FTVYRTNTSEVLFSTASHPIIFEDQYLRLKTSLPENANIYGLGEHTNSFRLDNHNTTLTM
ASHLYCVYYNIHLPLLQFNRDAYGVPNATNLYGAHPIYQEHRETGTHGVLLLNSNGMDIK
LNQTDGQESTLEYNVIGGILDLYFFSGSESDPAAVARQYAELVGLPAEYPYWGYGLHQCR
YGYTDFVDVASVISNYSAAGIPLETMWTDIDYMYKRRTFSLDPDYFPLDRMQEIIDYLHE
HEQQYILMTDPAVAYAPDSNYEAYDLGVEMDIFLKAANGSDFLGLVWPGVTVYPDWFNEK
TLEYWTHMYTTFYNKDTGLDIDGAWIDMNEPASFFDLTLNTSIWQQEKDQNLPPNRTTVA
PDYDTPIFGNDANSTVSANVSISLRRRDIMDPPYKIDNKQGALSANTAFANAKHANGLVE
YNTHNLYGAMMNNATRHAMLARRPGLRPLIITRSTFVGSGHLVGKWLGDNLSTWVHYRNS
IAGILGMASVYQVPMVGADICGFGGNTTETLCARWAMLGAFYPFMRNHNGDTSISQEYYL
WDTVAEAAKGAIETRFRLLDYIYTAMHKQHVDGTPLIAPLWHAYPKDTNTYPIDTQFLFG
PSVIVSPVIEENSTTVTAYLPDDVLYDWQTLSVVQGQGTNVTLNASFTEIPVHIRGGAVL
PLRVSGANTTAALRRTDFELVVAPGNDGSASGSLYVDDGVSVEQESTTEVDFVYVNGTLT
VDGKFDYDVGVQLRRVRFLGVGEQPKNVTLDGEEVQDVTFNATTGVLDVPVGRDFSAGFT
VVLA
NT seq 2715 nt NT seq  +upstreamnt  +downstreamnt
atgaagagcgcactcatcgccgcgacgctcgccgtcgcgcctgcgctcacgatgtacgtc
gaccccgcgaagctggacgcctgtgcagggtacgacgcgtcgaacgtctactctgacggc
acgaagctcaccgcgacgctcaacgtcgcgggagactgcggcgtctttggcgaggacatc
tccgagctcgcgctcgaggtcacgtatgagaccacgacgcgtctgcacgtcaagatctcc
gacgcggctcacccacggtatgaggtgcccgatgtcgtcgtccctcgcccgaccatcggc
gagggcgcgagccaggacaactccgagatccagttcaactatacggagtctccgttctcc
ttcactgtctaccgcaccaacacttctgaggtcctcttctccacggcctcacaccccatc
atcttcgaggaccagtacctccgcctcaagacaagcctcccggagaatgcgaacatctac
ggcctcggcgagcacacgaacagcttccgcctggataaccacaacaccacgctgaccatg
gcgagtcatctgtactgcgtgtactacaacattcacttacccctcttgcagttcaaccgc
gatgcttacggtgttcccaacgccaccaacctctacggagcccaccccatctaccaggag
caccgcgagaccggcacgcacggtgtcctgctgctcaactccaatggcatggacatcaag
ctcaaccagactgatggtcaagagtctacactcgagtacaacgtcattggtggcattctt
gacctctacttcttttccggaagcgaaagcgaccccgccgcggttgctcgtcagtatgcc
gagcttgtcggtctgcctgccgagtacccctactggggctatggcctgcaccagtgccgc
tacgggtacactgactttgttgatgttgcctcggtcatctcgaactactccgctgccggt
atccctctcgagacgatgtggacggacattgactacatgtacaagcgccgcacgttcagc
ttggacccggactacttccctctggaccggatgcaggagatcattgactaccttcatgaa
cacgagcagcagtacatcttgatgactgacccggctgtcgcgtacgcgcccgactcgaac
tacgaggcgtatgaccttggcgtggagatggatatcttcctcaaggcagccaatggcagc
gatttcctcggtctggtctggccgggtgtcactgtctaccctgactggttcaacgagaag
accctggagtactggacgcatatgtacactaccttctacaacaaggatactggcctggac
attgatggtgcttggatcgacatgaatgaacctgccagcttcttcgacctgaccctcaac
accagcatctggcagcaggagaaggaccagaacctgcctcccaaccgcaccaccgtcgcc
cccgactacgacacgcccatcttcggcaacgacgccaactcgactgtcagcgccaacgtc
tccatcagcctccgccgccgcgacatcatggacccgccgtacaagatcgataacaagcag
ggcgcgctctctgcgaacaccgcgttcgcgaacgccaagcacgccaatggcctcgttgag
tacaacacgcacaacctgtacggcgcgatgatgaataacgcaacccggcacgcgatgctg
gcgcgcaggcctggcctgcgcccgctcatcatcacacggtcgacttttgtgggctcgggc
catctggtgggcaagtggctcggcgacaacttgagcacttgggtgcactaccggaactcg
atcgcgggtattcttggtatggccagtgtgtaccaggtccccatggtcggcgcggatatt
tgtggctttggtggcaacaccactgagaccctgtgcgcgcgttgggctatgctcggcgcg
ttctatcccttcatgcgtaaccacaacggtgacactagcatcagccaggagtactacctc
tgggatactgtcgctgaagccgccaagggcgctatcgagacccgcttccgcctcctcgac
tacatctacaccgccatgcacaagcagcacgtcgacggcacgccgctcatcgccccgctc
tggcacgcctatcccaaggacacgaacacctaccccattgacacgcagttcctcttcggc
ccctccgtcatcgtctccccggtcatcgaggagaactcgacgacggtgaccgcgtatctc
cccgacgacgtcctctacgactggcagaccctgtccgttgtgcagggccagggcacgaac
gtcacgctgaacgcgagcttcacggaaataccggtgcacatccgcggtggcgccgtcttg
cccctgcgcgtgtcgggcgccaacacgaccgccgccctccgccgcacggacttcgagctc
gtcgtcgcgccgggcaacgacggctctgcttctggcagcctgtacgtcgacgatggcgtc
agcgtcgagcaggagagcacgacggaggtcgacttcgtctacgtgaacggcacgctgacc
gtggatggcaagttcgactacgatgttggcgtgcagcttcggcgtgtgcgcttcctcggc
gtcggtgagcagccgaagaacgtcacgctcgatggggaggaggtgcaggacgtgaccttc
aatgcgacgactggggtgctcgacgtcccggtcgggcgcgacttcagcgctggcttcacg
gtggtgttggcgtag

DBGET integrated database retrieval system