KEGG   Schizophyllum commune: SCHCODRAFT_67364Help
Entry
SCHCODRAFT_67364  CDS       T01331                                 

Definition
(RefSeq) hypothetical protein
  KO
K02320  DNA polymerase alpha subunit A [EC:2.7.7.7]
Organism
scm  Schizophyllum commune
Pathway
scm03030  DNA replication
Brite
KEGG Orthology (KO) [BR:scm00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    SCHCODRAFT_67364
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:scm03032]
    SCHCODRAFT_67364
Enzymes [BR:scm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     SCHCODRAFT_67364
DNA replication proteins [BR:scm03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase alpha / primase complex
    SCHCODRAFT_67364
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_pol_B zf-DNA_Pol DNA_pol_B_exo1 DNA_pol_alpha_N CAP_N DNA_pol_B_2
Motif
Other DBs
NCBI-GeneID: 9595763
NCBI-ProteinID: XP_003032739
UniProt: D8Q0Y7
LinkDB All DBs
Position
Unknown
AA seq 1394 aa AA seqDB search
MSNRKSKLEQLAELKRVRAGGKRVLKQEEDTEIYDEVSEEQYRAIVRGRLQEDDFVEDDG
VDGYMDTGVEEWEATRDYDDDEEDDRRRDKKSKKSAKGKAKAKPPPPPQPAPSMNAYRPK
VTEEQEQDFMANLLGELDTVPVKPALTTRTSRKRKPAPSPERKSSTDKYRYRERDREDEP
IRSPTKRPRTEATTMAATTNSLAAMDFDDITMDDLNDWDNDMDFDFPAKPKVDPPPAKPE
VLVDKKPFPSANATPAKPKEKEIDTKPSWINVYESLNVAETDKLGPSTTTHTSAQHAGID
ALEPDGSLRFFWLDYLELNGNVYFIGKLKDKKTNQWHSCCVTVENIERNLFVLPREKRVE
QGSDGEIYDTDEPVEMEDVYNDFDMIRGALKIKQWKGKFVKRKYAFGDKEVPRGESTWLK
VVYPFTEPTIPMDAISPNILKIFGTNTSAFELLVLKRKIMGPCWLQIKNPDVNFKGVSWC
KFEATVSDPKDINPFPETDHQAPKETPPLTVMSLSVRTIVNHVQNKREIVCATARIWHNL
DIDDPTPPERLPCTVQTFVRPLDKFPPRFEACAKQNMRGTITAAKNERMLLSSLLIALHR
ADADVIVGHDFVGVTLDVLLTRMKELTVDHWSRIGRFRRSKWPHIGKEGTNIRFMNGRML
CDLSSDGAKSMIPSTTWSMTEMCKTHLKVERQDIDPDDTASYFDGSVSNPDRLLTFVRHC
ELDAHLQMAIAAKVQILPLTKQLTQLAGNSWNKTLNGGRAERNEYILLHEFHRLKYICPD
KTYGKKAAPVREDPDEEGGGTSKKGAKRDKYKGGLVLAPKRQLWETYILVMDFNSLYPSI
IQEYNIDFTTVSRGTDIGQTPDDEAELPSSEAGQGVLPRLIATLVSRRRQVKNLMKDKNV
TQAQYLQVCIYDIKQQALKLTANTMFLSLLVVYGDTDSVFVNSNQTELSKALKIANEFKK
AVNDRYRLLEIDLDGVFQRLLLLQKKKYAAIKVDGSTTTTEIKGLDMKRREYSQLSKRVS
QYVLDRILSGEPTEIVVEEIHEYLAKIGEDVRGGKVPLDEFIIFKRLGKNPEDYPDAKSQ
PHVQVALRMKAKGSSARAGDVIPYVFCLPEGEETAGKTSQADRAKHPDDVRRSGSGLIID
YEHYLSQQVLPPIERLCEPIEGTDRARLAECLGLDPQRYKVSNSASDELSISTLETQMSD
RERFKDCVAFFVRCRKCKATDVFARLNEQTVDPTGVPRDPMLHPDGAKCTACQEKLQPWS
LEMQLQAQIRGFITRYYEGWTVCDDPTCGQRTRRMGVYGHNCVREGCQGKVSFEYTDAQL
YTQLKYFSSLFDVEKAFEIAKSKGNARVEHDKVQGLAAGNVVLLDTLRACTDRYLDMCGR
RWVSLNNLFSFMTM
NT seq 4185 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaccgcaagtcgaagctagagcagctagccgagctgaagcgcgtgcgcgcgggc
ggcaagcgcgtactaaagcaagaagaggacactgaaatctacgacgaagtcagcgaggag
caatatcgcgcgatcgtacgcggacggcttcaggaggacgatttcgtcgaagatgatggc
gtggatgggtacatggacacgggcgtggaggagtgggaagctactcgtgattacgatgat
gacgaagaggacgataggcgtcgagacaagaagtccaaaaagtctgccaaggggaaggcg
aaagccaaaccacctcctcccccgcagccggcgccctccatgaacgcgtaccggccgaag
gtgacggaggagcaagagcaagacttcatggcgaacctgctcggcgagctcgacacggtg
cctgtaaagccagcgcttacgacgcgtacgtcgaggaagcgcaagcccgcaccatccccc
gagcgcaaatcatcaacggacaagtaccgctacagggaacgcgacagggaggacgagccc
atccgcagcccgactaaacgcccaaggacagaagcgacgacgatggccgcgaccaccaac
tcgcttgcagctatggactttgacgacatcaccatggacgacctcaacgactgggacaac
gacatggacttcgactttcccgcgaagcctaaggtggacccgccaccggccaagccggag
gtcctcgtcgacaagaagcccttcccgagcgccaacgccacacccgctaagcccaaggag
aaggagatcgacaccaagccgtcctggatcaacgtctacgagtccctcaacgttgccgag
accgacaagctcgggccctccactactacccacacttctgcgcaacacgcaggcatagac
gcgctcgagcccgatggctcgcttcgcttcttctggcttgactacctggagctgaacggg
aatgtgtacttcatcggcaagctaaaggacaagaagacaaaccagtggcactcgtgctgt
gtcactgtcgaaaatatcgagcgcaacctgttcgttctgccccgcgagaagcgcgtagag
caagggagcgacggggagatctacgatacggacgagccggtggagatggaggatgtgtac
aatgactttgacatgatccggggcgcgctgaagatcaagcagtggaaggggaagttcgtg
aagcggaagtatgcgtttggtgacaaggaggtgccgaggggggagagtacgtggttgaag
gtggtatatccattcacggagccaacgattccgatggacgcaataagtccgaatatcctg
aagatcttcggcacgaatacttctgcatttgagctgctcgtcctcaagaggaagatcatg
ggtccttgctggctgcagatcaagaacccagatgtcaactttaaaggggtttcctggtgc
aagttcgaggccactgtctccgaccccaaggacatcaacccattccccgagacagaccac
caggcgccgaaggaaacgccgccgttgaccgtgatgagcttgagcgtgcgcacgattgtg
aaccacgtgcagaacaagcgtgagattgtgtgcgcgacggcgaggatatggcataatctc
gacatcgacgaccccacgccaccggagagactgccatgcacggtacagacgttcgtgcga
ccgctggacaagttcccgcccaggttcgaggcgtgcgcgaagcagaatatgagggggacg
attactgcggcgaagaacgagcgtatgctgctgagtagtcttttgatcgccctccaccgc
gcggacgccgatgtcatcgtcgggcacgatttcgtcggcgtaaccctggacgtgctgctc
acgcgcatgaaggagctgacggtcgaccattggtcccggataggccgcttcagacgctcc
aagtggccgcatatcgggaaggaggggacgaatatccggttcatgaatggtcgtatgctt
tgcgacctgtcgagtgatggagcgaagagcatgatcccctcgacaacatggtcgatgacc
gagatgtgcaagacgcatctgaaggtcgagcgccaggacattgacccggatgacacggct
agttacttcgacgggtcggtcagcaacccggacaggttgctgacgttcgtccgccactgt
gagctcgacgcccacttgcagatggctatcgcggcgaaggttcaaatcctgccgttgacg
aagcagctgacgcagcttgcgggtaactcatggaacaagaccctcaacggcggtcgtgcg
gagcgcaacgaatacattctgctgcacgaattccaccgcctcaagtacatctgccccgac
aagacctacggcaagaaggccgcgcccgtccgcgaggaccctgacgaggagggcggcggc
accagcaagaagggcgcgaagcgcgacaagtacaagggtggtctcgtgctggcgccgaag
cggcagctgtgggagacgtacatcctggtcatggacttcaactcgctgtacccgagtatc
atacaggagtacaatatcgactttacgacggttagtcggggaactgacattggacagact
ccggacgatgaggcggagctgccgagtagcgaggctgggcagggtgtcttgccgaggctt
atcgccacgctcgtcagtcgtcggcgacaagtgaagaacctgatgaaggacaagaacgtt
acgcaggctcagtacttgcaggtgtgtatctacgacatcaagcagcaagcgctcaagctc
actgccaacacgatgttcctctcgctgcttgtcgtctacggcgacacggactccgtcttc
gtcaactccaaccagaccgagctctccaaagccctcaagatcgccaacgagttcaagaaa
gctgtcaacgaccgctaccgactgctcgagattgacctcgacggtgtcttccagcgccta
ttgctcttgcagaagaagaagtatgcggcgatcaaggtggatgggtcgacgaccacaacg
gagatcaagggtttggatatgaagcgccgagagtactcgcagctgtcgaagcgggtgtcg
cagtacgtgctagatcggatcctgtctggggagccgacggagattgtcgtggaggagatc
cacgagtacctggccaagattggcgaggatgtgcgcggagggaaagtgcctttggatgaa
ttcatcatcttcaagcgcttgggaaagaaccccgaggactatcccgacgcaaagtcccag
ccgcacgtccaagtcgcgctgaggatgaaagccaaaggttctagcgcacgcgcgggagat
gtcattccctacgttttctgcttaccagaaggcgaggagacggcagggaagacatcgcag
gcagaccgggccaagcatccggacgatgttcgtcgttcgggctcgggcctcattatcgac
tacgagcactacctatctcagcaagttttaccgcccatcgagcgtctttgcgaacctatc
gaaggcactgatcgtgctcgacttgctgaatgccttggcttggaccctcaacgatacaaa
gtgtcgaatagcgcctctgacgagctatccatctcgacattggagacccagatgtcggat
cgcgaacggttcaaggactgcgtcgccttcttcgtgcggtgtcggaagtgcaaggccacc
gatgtatttgcccgcctgaatgagcagactgttgacccgacgggtgtgccgagggatccc
atgcttcaccctgatggcgccaaatgcactgcttgccaagagaagctccaaccctggtcc
ctcgagatgcagcttcaagcgcagatcaggggcttcatcacccggtactacgagggctgg
acggtgtgcgatgatccgacgtgcggacagcggaccaggcgaatgggcgtctatggacat
aattgtgtgagggaagggtgtcagggcaaggtatcgttcgagtatacggacgcgcaactc
tacacgcagctgaagtacttttcttcgttgttcgacgtcgagaaggcgttcgagattgca
aagtccaaggggaatgcgagggttgagcatgacaaggttcaggggctggctgcaggcaat
gtggtattgttggacacgctccgagcctgcaccgaccgctatctagatatgtgtggacgt
cgttgggtcagcctcaacaacctgttctcgttcatgaccatgtag

DBGET integrated database retrieval system