KEGG   Schizophyllum commune: SCHCODRAFT_74617Help
Entry
SCHCODRAFT_74617  CDS       T01331                                 

Definition
(RefSeq) hypothetical protein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
scm  Schizophyllum commune
Pathway
scm00020  Citrate cycle (TCA cycle)
scm00190  Oxidative phosphorylation
scm01100  Metabolic pathways
scm01110  Biosynthesis of secondary metabolites
scm01130  Biosynthesis of antibiotics
scm01200  Carbon metabolism
Module
scm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
scm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
scm_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:scm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SCHCODRAFT_74617
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SCHCODRAFT_74617
Enzymes [BR:scm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SCHCODRAFT_74617
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 FAD_binding_3 Lycopene_cycl DAO TAL_FSA HI0933_like
Motif
Other DBs
NCBI-GeneID: 9595894
NCBI-ProteinID: XP_003036033
UniProt: D8PX18
LinkDB All DBs
Position
Unknown
AA seq 639 aa AA seqDB search
MFRPTLRKCLLRPHRSFSTTAPARKVVATNPVKAQEVPSWASGKYPLIEHEYDAVVVGAG
GAGLRAAFGLAEAGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGS
DWLGDQDAIHYMCREAPKTVIELEHFGVPFSRTKEGKIYQRAFGGQSLKYGKGGQAYRCA
AAADRTGHALLHTLYGQSLRHNTNFFIEYFALDLIMQDGECVGVIALNLEDGTLHRFRSH
KTVLATGGYGRAYFSCTSAHTCTGDGNAMVARAGLPLQDLEFVQFHPTGIYGAGCLITEG
SRGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTIEIREGRGVGPEKDHCYLQLSH
LPAEILHERLPGISETAAIFSGVDVTKEPIPVLPTVHYNMGGIPTKYTGEVITVDENGKD
KVVPGLYAAGEAACVSVHGANRLGANSLLDIVVFGRACAHHIEETLTPGKPHKKIPDEAG
IESIEFLDQIRKADGPIPTAKIRLDLQKAMQSDAAVFRTQESLDEGVQKVKQIYETYKDV
GIKDRSMIWNSDLVETLELRNLLQCAVQTITSAAARKESRGAHAREDFPERDDESWMKHT
LSFQNDSTKPDVKLSYRGVIDKTLDENECKAVPPFKRVY
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgttcaggcccacgctcaggaagtgtctccttcggcctcaccgctccttctccaccacc
gcccccgcgaggaaggtcgtcgcgacaaaccccgtcaaggcgcaggaggttccgtcttgg
gcatcagggaaatatcccttgattgagcacgagtacgatgcggtcgttgtaggtgctggt
ggcgcgggcttgcgagcagcgttcggtctcgccgaagctggcttcaacacggcatgcatt
accaagcttttcccgactcgaagccacaccgttgcggcgcagggagggatcaacgcagcg
ctcggaaacatgaccgaggacgactggagatggcatatgtacgacacggtcaagggttcc
gactggcttggagaccaggacgccatccactacatgtgtcgcgaggcgcctaagaccgtc
attgagctcgagcacttcggtgttcctttctcacgcacgaaggagggcaagatctaccag
cgcgccttcggtggccagtcgctgaagtacggcaagggaggtcaggcgtatcgctgcgct
gccgccgctgaccgtaccggtcacgccctcctccataccctctacggccaatccctccgc
cacaacaccaacttcttcatcgagtacttcgcactcgacctcatcatgcaggatggtgag
tgtgtgggtgtgatcgccctcaacctcgaggacggcaccctccaccgcttccgttcgcac
aagaccgtcctcgcgacgggtgggtacggacgagcgtacttcagctgcaccagtgcgcac
acgtgcacgggtgacggtaacgccatggtcgcccgtgccggccttcccctccaggatctg
gagttcgtccagttccatcccacgggtatctacggtgctggttgcctgatcactgagggt
tctcgcggtgagggaggctacctcctcaactctgagggtgagcgctttatggagcgttac
gcaccgaccgcgaaggatcttgcctctcgtgatgtcgtgtctcgtagcatgacgatcgag
attcgcgagggtcgcggtgtcggtcctgagaaggatcactgctacctccaactcagccat
ctgcccgccgagattttgcacgagcgtctcccgggtatttctgagaccgccgctatcttc
tctggtgtcgatgtcaccaaggagcccatccccgtcttgcccaccgtccactacaacatg
ggtggtattccgacgaagtacactggcgaggttatcacggtcgacgagaacggcaaggac
aaggttgtccccggtctctacgccgccggtgaggctgcctgtgtttccgtccatggtgcc
aaccgtctcggtgcgaactccctgctcgatatcgtcgtcttcggccgtgcttgcgcgcac
cacatcgaggagacccttacccctggcaagccgcacaagaagattcccgatgaggctggc
atcgagagcatcgagttccttgaccagatcaggaaggctgacggtcccatccccaccgct
aagatccggttggacctccaaaaggccatgcagtcggacgctgctgtgttcaggacgcag
gagtcgttggacgagggtgtgcagaaggtcaagcagatctacgagacctacaaggatgtc
ggtatcaaggatcgctcgatgatctggaactctgacctcgtcgagacgctcgagctccgc
aacttgctccagtgcgccgtgcagaccatcacctccgccgcagcccgcaaggagtcccgc
ggcgcccacgcacgcgaggacttccccgagcgcgacgacgagagctggatgaagcacacg
ctttccttccagaacgactcgacgaagccggacgtcaagttgtcgtaccgtggtgtcatc
gacaagacgctggatgagaacgagtgcaaggcggtgccgccgtttaagcgtgtgtactag

DBGET integrated database retrieval system