KEGG   Schizophyllum commune: SCHCODRAFT_76684Help
Entry
SCHCODRAFT_76684  CDS       T01331                                 

Definition
(RefSeq) hypothetical protein
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
scm  Schizophyllum commune
Pathway
scm00250  Alanine, aspartate and glutamate metabolism
scm00410  beta-Alanine metabolism
scm00430  Taurine and hypotaurine metabolism
scm00650  Butanoate metabolism
scm01100  Metabolic pathways
scm01110  Biosynthesis of secondary metabolites
Module
scm_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:scm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SCHCODRAFT_76684
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SCHCODRAFT_76684
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SCHCODRAFT_76684
   00430 Taurine and hypotaurine metabolism
    SCHCODRAFT_76684
Enzymes [BR:scm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     SCHCODRAFT_76684
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 9596316
NCBI-ProteinID: XP_003032230
JGI: Schco1_76684
UniProt: D8Q508
LinkDB All DBs
Position
Unknown
AA seq 542 aa AA seqDB search
MPLSRHIQPEDVLAASRDHPHRKHTDRHERHVLEQSWTRDEDAASAPKYTFPTRGIPSKA
AYQLLHDEAALDGNPTLNLASFVHTWMPDDGVRLFNEAIDKNLADQDEYPAAQIIHNRCV
SMLAHLWKAPTADTTAVGTATAGSSEAIMLAGLALKKRWQDARKRAGKDHYHPNIVFGAN
AQVALEKFARYWDVEARMVPVNRETSYVLKPEDAIQYIDENTIGVMVILGSTYNGAFEDV
GRMSGLLDDLQERTGLDIPIHVDAASGGFIAPFAYPEYKWAFDVSRVVSINSSGHKFGLV
YPGLGWLIFRDESCLHKDLVFELHYLGSVEYSYTLNFSKPAAPVFAQMFNFLNLGYNGYA
KIAFKDLRNARMLARALERTYFTVLSEIHRPAPDAPAGVDEEDPQFYVKGLPVVTFRLND
EYKQKYPHVKQAWIQTSLRTKGWIVPNYNAPKGEEQTEMLRVVVRESMTEDLIERLIVDI
LQIVEAFMDDSDGTQMMIAYTGGSGPHQPDMEHSRPKAANFGGADKKVDESVVPQAGYSR
QC
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgcccctctcccgccacatccagcctgaggacgtcctcgccgcctcgcgcgaccacccc
caccgcaagcacaccgatcgccatgagcggcacgtcctcgagcagtcctggacgcgcgac
gaagacgcggcctccgcgcccaaatacaccttccccacgcgcggcatcccctccaaggcc
gcgtaccagctcctccacgacgaggccgcgctcgacggcaacccgaccctgaacctcgcg
tccttcgtgcacacctggatgcccgacgacggcgtgcggctgttcaacgaggcgatcgac
aagaacctcgcggaccaggacgagtacccggcggcgcagatcatccacaaccgctgcgtg
tcgatgctcgcgcacctgtggaaggcgccgaccgcggacacgacggcggtcgggacggcg
acggcgggctcgtcggaggcgatcatgctcgcgggcctcgcgctgaagaagcgctggcag
gatgcgaggaagcgggccgggaaggaccactaccatccgaacatcgtttttggcgcgaac
gcgcaggttgcgctggagaagttcgcaagatactgggacgtcgaagcgcgcatggtgccc
gtcaaccgcgagacgtcctacgtcctgaagccggaagacgccatccaatacatcgacgag
aacaccatcggcgtcatggtcatcctcgggtcgacctacaacggcgccttcgaggatgtt
gggcgcatgagcggccttctcgacgacctccaggagcgcacaggcctcgacatccccatc
cacgtcgacgccgccagcggaggcttcatcgcgcccttcgcgtaccccgaatacaagtgg
gcattcgacgtctcgcgcgtagtcagcatcaactcctccggccacaaattcggcctcgta
taccccggcctcggctggctcattttccgcgacgagagctgcctgcacaaggacctcgtc
ttcgagctgcactacctcggctccgtcgaatactcctacacgctcaacttctccaagccc
gccgcgcccgtgttcgcccagatgttcaacttcctcaacctcgggtacaacggctacgcc
aagatcgccttcaaggacctccgcaacgcgcgcatgctcgcgcgtgccctcgagcgcacg
tacttcaccgtgctctccgagatccatcgccccgcgccagatgcgccggcgggtgtggat
gaggaggacccgcagttttatgtgaaggggctgcccgtggtgacgttccgcttgaatgac
gagtacaagcaaaagtacccgcatgtgaagcaggcgtggatccagacgagtttgcggacg
aagggctggatcgtcccgaattacaacgcgcccaagggcgaggagcagacggagatgctg
cgcgtcgtcgtgcgcgagagcatgacggaggacctcattgagcgtctgatcgtcgatatc
ctgcagatcgtggaggcgtttatggacgactccgacggtacccagatgatgattgcgtac
acgggaggcagtgggccgcaccaaccggacatggagcactcgcgtcccaaggcagcaaac
tttggcggcgcagacaagaaggtagacgagtcggtggtcccgcaggcagggtacagccgg
cagtgctaa

DBGET integrated database retrieval system