KEGG   Schizophyllum commune: SCHCODRAFT_81665Help
Entry
SCHCODRAFT_81665  CDS       T01331                                 

Definition
(RefSeq) hypothetical protein
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
scm  Schizophyllum commune
Pathway
scm00020  Citrate cycle (TCA cycle)
scm00310  Lysine degradation
scm00380  Tryptophan metabolism
scm01100  Metabolic pathways
scm01110  Biosynthesis of secondary metabolites
scm01130  Biosynthesis of antibiotics
scm01200  Carbon metabolism
Module
scm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
scm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:scm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SCHCODRAFT_81665
  09105 Amino acid metabolism
   00310 Lysine degradation
    SCHCODRAFT_81665
   00380 Tryptophan metabolism
    SCHCODRAFT_81665
Enzymes [BR:scm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     SCHCODRAFT_81665
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 9585420
NCBI-ProteinID: XP_003034373
JGI: Schco1_81665
UniProt: D8PZN4
LinkDB All DBs
Position
Unknown
AA seq 1001 aa AA seqDB search
MLTRQLAKRSPAALSAGAPRTRFPTSAIRRELATPAAQPPSPNDPFANGTNAYYADEMYR
LWKQDPNSVHASWNVYFSGLAKGLPSSQAFTPPPRLLPTDGVTPALHAGQGELDDHLKVQ
LLVRAYQVRGHHVADLDPLGILDADLADVRPPELELHRYGFTERDLDKEITLGPGILPHF
ATEDRKTMKLGEIIKLCKRIYCGHVGIQYVHIPDREQCDWIRERVEIPKPWNYSVDEKRM
ILDRLIWSESFEKFIASKYPNEKRFGLEGCESLIPGMKALIDRSVDHGVKHVNIGMPHRG
RLNVLANVIRKPIEAILNEFSGAEGDEPAGDVKYHLGANYVRPTPSGKKVALSLVANPSH
LEAEDPLVIGKTRAIQHFEKDDQNHNTAMSVLLHGDAAFAGQGVVYETMGMHDLPNYGVG
GTIHLIVNNQIGFTTDPRFARSTPYPSDIAKSIDAPIFHVNGDNVEAVNFVCQLAADYRA
KYKRDVVVDIVCYRRHGHNETDQPAFTQPRMYKAIAKQPTTLTKYSKFLVERGTFTEKDI
EEHKKWVWGMLEKAAAGAKDYVPTSKEWLSSAWQGFPSPKQLAEETLPTRVTGSEEETLK
RIGKAISTFPHGFHPHKNLTRILTNRGKTVEEGNNIDWSTAEALALGSLALEGVHVRVSG
QDVERGTFSQRHAVVHDQETESKYVPLNDLGGNQASVTVCNSSLSEFGCLGFELGYSLVS
PDALTIWEAQFGDFANNAQCIIDQFIAAGERKWLQRTGLVMSLPHGYDGQGPEHSSARIE
RFLQLCDDHPNVFPTPDKIERQHQDCNMQVVYPTTPANYFHVLRRQIHRDFRKPLILFFS
KQLLRHPRARSELSEMVGETNFQRYIPEAHTDELVAPEDIRKHILCTGQVYHTLIAEREA
KGIKDVAISRVEQISPFPYDLITPHLDKYPNAELMWCQEEPLNNGAWSYVGPRIYTAGGQ
TQHHKGKYPKYAGREPTSSVATGSKVQHKKEIEAFLADAFA
NT seq 3006 nt NT seq  +upstreamnt  +downstreamnt
atgttgacaaggcagcttgcaaagcgctcccccgctgctctcagcgctggcgccccgcgg
acgcgtttcccgaccagcgcgatccgccgggagctcgccacgcccgccgcgcaaccgccg
tccccgaacgacccattcgcgaatggcacgaacgcgtactacgccgacgagatgtaccgc
ctgtggaagcaggacccgaattcggtccacgcctcctggaacgtctacttctccggcctc
gccaagggcctgccgagcagccaggcttttacgcctcccccgcgcttgctgcctaccgac
ggcgtgacgccagctcttcatgctggtcagggcgagcttgatgaccatttgaaggttcaa
ctcctcgtccgcgcataccaagtccgcggccaccatgtcgccgacttggatccccttgga
atccttgacgctgacctcgccgatgtccgccctcctgagctcgagcttcaccgatatggc
ttcacggagcgcgatctcgacaaggaaattacccttggtccgggcatccttccccacttc
gctacggaggacaggaaaacgatgaagcttggcgagatcatcaaactgtgcaaacggata
tattgcggtcacgtcggcatccaatacgtgcacatccctgatcgcgagcagtgcgactgg
atccgtgagcgcgtcgagatcccgaagccgtggaattacagcgtcgatgagaagcgcatg
atcctcgaccgtctcatctggtccgagtcgttcgagaagttcatcgccagcaagtacccg
aacgagaagcgcttcggtctcgagggatgcgagtccctcattccgggtatgaaggccctc
atcgaccgctctgtcgaccacggcgtgaagcacgtcaacattggcatgccccatcgtggc
cgtctcaacgttcttgccaacgtcatccggaagcccatcgaggctattctcaacgagttc
tccggagcggaaggcgatgagcccgccggtgatgtcaagtaccatcttggtgctaactac
gtccggccgaccccctccggtaagaaggttgccctgtcgctcgtggcgaacccgtcccat
cttgaggcggaggaccctctcgtcatcgggaagactcgtgccatccagcacttcgagaag
gacgatcagaaccacaacactgcgatgtccgttctgctgcacggtgacgctgctttcgct
ggtcagggtgtcgtctacgaaaccatgggcatgcatgatctccccaactatggcgttggc
ggtaccatccatctcatcgtgaacaaccagattggcttcaccaccgacccccgctttgcc
cgctccaccccctacccctccgatatcgccaagtccatcgacgcgcctatcttccacgtc
aacggcgacaatgtcgaggctgttaactttgtttgtcagctcgccgccgactaccgtgcg
aagtacaagcgcgacgtcgttgtcgacatcgtttgctaccgtcgacacggtcacaacgaa
accgatcaaccggcgttcacccagccgcggatgtataaggctatcgcgaagcagccgacg
accttgacgaagtactccaagttcctcgtcgagcgcggtaccttcacggagaaggacatt
gaggagcacaagaagtgggtttggggcatgcttgagaaggctgccgctggcgccaaggac
tatgtcccgacgagcaaggagtggctttcttctgcgtggcagggcttcccctcgcccaag
cagctcgcggaggagacgctccctacgcgcgtcaccgggtcagaagaggagaccttgaag
cgcattggcaaggccatctcgaccttcccccacggcttccacccgcacaagaacctcacc
cgtatcctcactaaccgtggcaagacggtcgaggagggtaacaacatcgactggtccacc
gctgaggcgctcgcgctcggctcccttgccctcgagggtgtgcacgtccgcgtgtctggc
caggatgtcgagcgtggtacgttctcgcagcgccacgctgtcgtccacgaccaggagacc
gagtcgaagtacgtccccctcaacgacctcggcggcaaccaggcctcggtcaccgtctgc
aactcgtcgctatctgagtttggctgccttggtttcgagctcggctactcgctcgtgtcg
ccggatgcgcttacgatctgggaggcgcagttcggtgacttcgcgaacaacgcgcagtgc
atcatcgaccagttcatcgctgctggcgagcgcaagtggcttcagcgcactgggctcgtc
atgagcttgccgcatgggtacgatggacagggcccagagcactcgagcgcgcgcatcgag
cggttcttgcagctgtgcgacgatcacccgaacgtgttccccacgccggacaagattgag
cgtcagcaccaggactgcaacatgcaggtcgtctaccccacgacgccggccaactacttc
cacgtccttcgccgccagatccaccgcgacttcaggaaaccgctcatcctgttcttctct
aagcagcttctgcgtcacccgcgtgcgcgctcggagttgtctgagatggttggcgagacc
aacttccagcgctacatccccgaggcgcacaccgatgagcttgttgcgcctgaggacatc
aggaaacacatcctatgcacgggtcaggtgtaccacacgctcatcgctgagcgtgaggcg
aagggcatcaaggacgtcgcgatcagccgcgttgagcagatctcgccgttcccctatgac
ctgatcacgccccacctcgacaagtacccgaacgctgagctcatgtggtgccaggaggag
ccgctgaataacggcgcgtggagctacgtcgggccccgcatctacacggcgggtggccag
acgcagcaccacaagggtaagtaccccaagtacgccggccgcgagccgacgagctcggtc
gctactggttccaaggtccagcacaagaaggagatcgaggcgttccttgcggatgcgttc
gcataa

DBGET integrated database retrieval system