KEGG   Schizophyllum commune: SCHCODRAFT_82470Help
Entry
SCHCODRAFT_82470  CDS       T01331                                 

Definition
(RefSeq) glycosyltransferase family 15 protein
  KO
K10967  alpha 1,2-mannosyltransferase [EC:2.4.1.-]
Organism
scm  Schizophyllum commune
Pathway
scm00514  Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:scm00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    SCHCODRAFT_82470
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:scm01003]
    SCHCODRAFT_82470
Enzymes [BR:scm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     SCHCODRAFT_82470
Glycosyltransferases [BR:scm01003]
 Glycan extension
  Yeast mannan chain
   SCHCODRAFT_82470
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_15
Motif
Other DBs
NCBI-GeneID: 9587455
NCBI-ProteinID: XP_003031330
UniProt: D8Q7I4
LinkDB All DBs
Position
Unknown
AA seq 385 aa AA seqDB search
MHTSARYVILALTILISLHYILSSTHEAYGNATSIDSLASRLRGRPSDKVIVPEEYYDTP
AIPGTNHSSPHHDRPSATFVILARNSDLDSTIQSVRNVEDRFNRKYKYPYVFLNDEPFSE
EFKSRLSNIISSTAEFGLVPREHWVQPDWIDEEKASASRKKMEEDNIIYGGSLSYRNMCR
FNSGFFFRHPLLDKYRWYWRIEPDVQFHCDLDFDPFVYMQENNKVYAFTIAMYEFEATIP
TLWSTVKDFIKEHPEYVAEDNAMGFLSDNNGDSYNLCHFWSNFEIADLEFWRGPAYTAFF
DYLDKRGGFYYERWGDAPVHSIAAALFAKREQIQFFDEIGYSHNPYTHCPQSEAKWRRGK
CACDQKRSFDYDGYSCMRQWDRIQG
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgcacacgtccgcccgctatgtcatccttgccctcaccatccttatttccctccactac
attctttcttcgacgcacgaagcatacggaaatgccacgtcaatcgacagcctcgcatcc
cgcctgcgcggccggccatccgacaaggtgatcgtacccgaggagtactacgacaccccc
gcaattcccggcacgaaccactcgtccccccaccacgaccgcccgagcgcgaccttcgtc
atcctcgcgcgcaactcagacctggacagcacaatacagagcgtgcgcaacgtcgaggac
cgcttcaaccgcaagtacaagtacccttacgtcttcctcaatgacgagcccttctcggag
gagttcaagagccggctctccaatatcatcagcagcaccgctgaattcggcctcgtcccg
cgcgagcactgggtccagccggactggatcgacgaggagaaggcttctgcgtcgcgcaag
aagatggaggaggacaacatcatttacgggggaagcctgtcgtaccgcaacatgtgccgc
ttcaactcgggcttcttcttccggcacccgctgctcgacaagtatcgctggtactggcga
attgagcccgatgtacaattccactgcgatctggactttgacccgttcgtgtatatgcag
gagaacaacaaggtgtacgcattcacgattgcaatgtacgaattcgaagctacgatcccc
acgttatggagcaccgtaaaagacttcatcaaggagcaccccgagtacgtcgcagaagac
aacgcgatgggtttcttgtcagacaacaacggcgactcgtataacctctgccatttctgg
tccaacttcgaaatcgccgacctcgagttctggcgcgggcccgcgtataccgccttcttc
gactacctcgacaagcgcggcgggttctactacgagcggtggggcgacgcgcccgtgcac
tcgatcgcggcggcgctgttcgcgaagagggagcagattcagttctttgatgaaatcggt
tactcccacaacccgtacacgcactgtccgcaaagcgaggcgaagtggcggcgcgggaag
tgcgcatgcgaccagaagcgcagctttgactacgatgggtactcgtgtatgaggcagtgg
gatcggatacagggttga

DBGET integrated database retrieval system