KEGG   Schizophyllum commune: SCHCODRAFT_83125Help
Entry
SCHCODRAFT_83125  CDS       T01331                                 

Definition
(RefSeq) hypothetical protein
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
scm  Schizophyllum commune
Pathway
scm00020  Citrate cycle (TCA cycle)
scm00480  Glutathione metabolism
scm01100  Metabolic pathways
scm01110  Biosynthesis of secondary metabolites
scm01130  Biosynthesis of antibiotics
scm01200  Carbon metabolism
scm01210  2-Oxocarboxylic acid metabolism
scm01230  Biosynthesis of amino acids
scm04146  Peroxisome
Module
scm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
scm_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:scm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SCHCODRAFT_83125
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SCHCODRAFT_83125
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    SCHCODRAFT_83125
Enzymes [BR:scm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     SCHCODRAFT_83125
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 9590428
NCBI-ProteinID: XP_003028629
JGI: Schco1_83125
UniProt: D8QDQ7
LinkDB All DBs
Position
Unknown
AA seq 396 aa AA seqDB search
MTRIIWKKIREELILPYVDLNIKYYDLGLEARDATDDQITVDAAKAILENKVGIKCATIT
PDEARVKEFNLKQMWRSPNGTIRNILGGTVFREPIILERVPKPVPGWVKPITIGRHAFGD
QYRSTDYIVPGAGRLELVFTPKDGSAPTTMNVFDFKDPGVAMAMYNTDESITGFAHASFK
MALAKGAPLFMSTKNTILKKYDGRFKDIFQEIYEAQYKADFEKKSIYYEHRLIDDMVAQA
IKSSGGFVWACKNYDGDVQSDILAQGFGSLGMMTSELITPDGDVIESEAAHGTVTRHYRE
WQKGNETSTNPVASIFAWTRGLLHRAKLDGNDALTAFCKDLEASCVEVIDKDGIMTKDLA
LAIHGKNMKREHWVVTNEYMDAVNDKLKSKIAARTA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgacacgcatcatctggaagaagatcagggaggagctcattctgccgtacgtggacctg
aacatcaagtactatgacctgggattggaggcgcgcgatgcgacggacgaccagatcacg
gtggacgcagccaaggccattttggagaacaaagtcggcatcaagtgcgcaaccatcacg
ccagatgaggcgcgcgtcaaggagttcaacctcaagcagatgtggcgctcccccaacggc
accatccgcaacatcctcggcggcacggtcttccgtgagcccatcatcctcgagcgcgtc
cccaagcccgttccgggatgggtaaagcccatcaccatcggccgccacgcattcggtgac
cagtaccgctcgacggactacatcgtccctggcgcaggccgcctcgagctcgtcttcacc
cccaaggacggctccgcccccaccaccatgaacgtcttcgacttcaaggaccccggtgtc
gccatggccatgtacaacaccgatgaatccatcactggcttcgcccacgcttctttcaag
atggcgctcgccaagggcgctccgctcttcatgtccacgaagaacaccatcctaaagaag
tacgacggccggttcaaggacatcttccaggagatctatgaggcgcagtacaaggccgac
ttcgagaagaagagcatttactacgagcaccgtttgatcgacgacatggtcgcgcaggcg
atcaagagctcgggcgggttcgtgtgggcgtgcaagaactacgacggtgacgtgcagtcg
gatatcttggcgcagggcttcggctcgctggggatgatgacctcggagctgatcacgccg
gacggggatgtgattgagtcggaggcggcgcatgggacggtcactcggcactaccgcgaa
tggcagaagggcaacgagacgtcgacaaacccggtcgcgtccatctttgcgtggactcgc
ggcctgcttcaccgcgccaagctcgacggcaacgatgcgttgacggcattctgcaaggac
ttggaggcgtcgtgtgtcgaggtcatcgacaaggacggcatcatgacgaaggatcttgcc
ctggctatccacggcaagaacatgaagcgcgagcactgggtcgtcacaaacgagtacatg
gacgccgtcaacgacaagctcaagagcaagatcgcggcacgtaccgcttga

DBGET integrated database retrieval system