KEGG   Solitalea canadensis: Solca_0722Help
Entry
Solca_0722        CDS       T02084                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
scn  Solitalea canadensis
Pathway
scn00564  Glycerophospholipid metabolism
scn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:scn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Solca_0722
Enzymes [BR:scn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Solca_0722
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 GIDA NAD_binding_8 HI0933_like Pyr_redox_3 Pyr_redox_2 Thi4
Motif
Other DBs
NCBI-ProteinID: AFD05846
UniProt: H8KPE8
LinkDB All DBs
Position
complement(869056..870615)
Genome map
AA seq 519 aa AA seqDB search
MKRTEMLAELNSMKGQTWDVIIVGGGATGLGAAVEATTRGYKTLLLEQEDFAKGTSSRST
KLIHGGVRYLQQGNVSLVLEALKERGLLIQNAPHLVHNLSFIVPNYSWWSGPFYGIGLKI
YDLLAGKLGLGPSEFLSVTETLKHIPTLEQEGLKGGVIYHDGQFDDSRLAINLAQTAADH
QATVLNYFKVSGFIKEDNLIAGVLATDQFDHQEYEIKAKVVINATGVFVDHLMQVDEPDS
SKIVAPSQGIHLVFDKKFLPGKSAIMVPNTDDGRVMFAIPWHNKVVVGTTDTPVENPELE
PKALPEEIEFILKHASRYLNEDPKIEDVKSVFAGLRPLVKNSNGNNTAALSRDHTILVSQ
SGLLTITGGKWTTYRRMGQDVIDKACEFCGLEDRNSITTSLKIHGWKQNTDITDPLDCYG
SDADGIKLLIKDNPELGERIHVDLPYVKAEVIWSIRNEMAITLEDVLARRTRALLLDAKA
TVESAATVADLMANEMSKNNEWIDLQVASFRKTASNYML
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaactgaaatgcttgccgaactcaattccatgaaaggacaaacatgggatgtt
attattgttggtggtggtgcaaccggtctgggtgccgctgttgaagctacaactcgcgga
tataaaacgctattgttagaacaagaagattttgccaagggtacatccagtcgttcaaca
aagctaattcatggtggtgttcgttatttacaacaaggaaatgtcagtttggtactggaa
gccttaaaagaacgcgggttattgatacaaaatgctcctcatctggtgcataacctttca
ttcattgttcctaactacagttggtggtcgggccccttttatggtattggcttaaaaata
tatgatcttttagctggaaaactcggtttaggcccatcggaattcctttcggttacggaa
acattgaaacatatacctacgcttgaacaggaggggttaaagggtggggtaatttatcat
gacggacaatttgatgactctcgactagctattaatctggcacaaacagcagctgatcat
caggctacagttcttaattattttaaagtttcaggatttattaaggaagataacctgatt
gcaggagttctcgcaacagatcagtttgatcatcaggagtatgaaattaaagcgaaggta
gtgatcaatgcaacgggtgtatttgtagaccatctaatgcaagtagacgagcctgattct
tcaaagattgtagcgccaagccagggaattcacttagtcttcgacaagaaattcttacct
ggaaaaagcgccatcatggttccaaatacagacgatggaagggtaatgtttgctattcca
tggcacaataaagtggttgttggcactactgacacacctgttgaaaaccctgagttggag
cccaaagccctgccagaggaaattgaatttatcttaaaacatgcatcacgctacctcaat
gaagatcctaaaattgaagatgtaaaaagcgtgtttgcaggattacgtccgttagttaaa
aacagcaatggcaataatacagcagcgctttcaagggaccatactattttggtgtctcaa
tcaggattattaactattactggaggcaaatggactacttatcgccggatgggacaagat
gtaattgataaggcatgtgagttttgtggtttagaggaccgtaactccattacaacttca
ttgaaaattcacggctggaaacaaaatacagacattaccgatccgctggattgctatggt
agtgatgcagatggcatcaaattgttaataaaagataatccggagttaggagagcgcatt
catgttgatttgccctatgtaaaagcagaggttatctggtctattagaaatgagatggcc
atcacccttgaagatgtattagcgcgccgtaccagagctttactgcttgatgccaaagcc
actgttgaaagtgctgctactgttgctgatcttatggcaaatgaaatgagtaaaaacaac
gaatggattgatctgcaggttgcgtcgtttcgcaaaacggcatctaattatatgctttga

DBGET integrated database retrieval system