KEGG   Solitalea canadensis: Solca_1259Help
Entry
Solca_1259        CDS       T02084                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
scn  Solitalea canadensis
Pathway
scn00473  D-Alanine metabolism
scn01100  Metabolic pathways
scn01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:scn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Solca_1259
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    Solca_1259
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:scn01011]
    Solca_1259
Enzymes [BR:scn01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Solca_1259
Peptidoglycan biosynthesis and degradation proteins [BR:scn01011]
 Precursor biosynthesis
  Racemase
   Solca_1259
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mur_ligase_M Mur_ligase Mur_ligase_C POB3_N
Motif
Other DBs
NCBI-ProteinID: AFD06348
UniProt: H8KVG8
LinkDB All DBs
Position
1512160..1514703
Genome map
AA seq 847 aa AA seqDB search
MKNLFLSKQKCFQSVHSDTHNNYICGTMPLTPYTLQYISNLLSANAQINNPQLPVETLAI
DSRKILSPEITLFFALKGQRNGHNFIPELINKGVKSFVISEDKWSEAYPGINFLLVPDTL
KALQLVAANHRKQFNYPVIGVTGSNGKTIVKEWLFQLLSIDHHIVRSPKSYNSQIGVPLS
VWQMNDMADLAIFEAGISMPNEMLNLVNVIQPTIGVFTNIGSAHNEGFESIEQKLTEKFK
LFGDVNTFIYPKDELTGFANEIPGKQQISWSTTDTSATVFVKEIERKSLHTKITGVIKAH
EHTIEIPFIDEASVKNAITCWCVLIALEIPQNQVKQRMKELAPIEMRLKLRKGVNNCTVI
NDSYNSDLGSLQIALDFLQQQQQHPKRTLILSDIFQSGISSKELYAKVAQLLASAKVDRL
IGIGPEIASQEQLFNLEKEFYVNTDAFLAEFSGAKFNNENILLKGSRLFEFEQISKLLEQ
KVHETVFEINLNGLIQNLNYYKSMLQPETKLMAMVKAFSYGSGSFEIANVLQFHKVDYLA
VAYVDEGVELRKAGIKLPIMVMSPDVFAFESLLRSNLEPELYNFRILNEFVSFLHTHHSQ
EYKIHLKIDTGMHRLGFQEEDIDKLVSILKANPHIKVASVFSHLAASEDAEEDGFTQKQL
DLFLRVADKLKQLLGYSFIRHICNSAGIVRHPEAHLDMVRLGLGLYGIDSAVKNNRLLQP
IGTLKTTITQIKELAPGETVSYNRRGKINVPSKIATVKLGYADGLSRKLGNGVGEMLVNG
KRAPIIGSVCMDMTMLNVTEIDCKETDEVIVFNEELRVEELAEKIGTIPYEVLTGISQRV
KRVYVYE
NT seq 2544 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacttatttttgagtaaacaaaaatgttttcaaagcgtccattccgatacgcac
aataactatatttgcggtactatgcctcttaccccatacacactccaatacataagtaat
ttactgagtgccaatgcacaaataaataatcctcaattgccggttgaaacattggctatc
gacagccggaaaatattgagtcccgaaataaccttattctttgcattaaaaggtcagcga
aacgggcacaactttattcctgaacttattaataaaggagttaaaagctttgtgatatcc
gaagacaaatggtcggaagcctatccgggtattaattttttattggtgcctgatacactt
aaagcgttacaattagttgcggccaatcatcgcaaacaatttaattacccggtaattgga
gtaacaggcagtaatggaaaaactatagtaaaagaatggctttttcaattactttcgatt
gatcatcatattgttagaagcccgaagagttataactcacaaataggagttcctctttcg
gtgtggcagatgaatgacatggccgacctggctattttcgaagccggaatctcgatgcca
aatgagatgttaaacctggtaaatgttattcaacctaccattggtgtttttaccaatatc
ggttctgcacataatgaaggttttgaaagcattgaacaaaagttgactgagaaatttaaa
ctgtttggagatgtgaacacgttcatttatccaaaagatgaattaacgggttttgcaaat
gaaattccaggcaaacagcagatcagttggtcgacaacagatacatctgcaactgttttt
gtaaaagaaattgaaagaaagtcactacatactaaaataacaggtgttattaaggcacat
gagcatacaatcgaaattccttttattgatgaagcatcagtaaaaaatgcgatcacatgc
tggtgtgtgttaattgcattagaaatacctcaaaatcaggtcaaacaacggatgaaagag
ctggcgccaattgaaatgcgcctgaaacttcgcaagggagttaataattgcactgtcatc
aatgatagctacaactctgatttagggtcgttgcaaattgcacttgactttctacaacag
caacagcaacatccaaaacgtacattaatactgtctgatatctttcaatccggaatttct
tccaaagaattatatgctaaagtcgcacagttgttagcatcagcgaaagtagatagattg
atcggcattggtccggaaatagcttcacaagaacagctgtttaatcttgagaaagagttt
tatgttaataccgatgcttttcttgctgaattttcaggagctaagtttaataatgaaaac
attttactgaaaggttcccgcttatttgagtttgaacaaattagtaaactccttgagcag
aaagttcacgaaaccgtttttgaaattaatctgaatgggttgatacagaatctgaactat
tataaatcgatgctacaacctgaaactaaattaatggcaatggtaaaggctttttcatat
ggaagtggaagctttgagattgccaatgtattgcagtttcataaagttgattatttggcg
gtggcttatgtagatgaaggtgttgaactacgaaaagcaggaattaaattaccaataatg
gttatgagtcctgacgtttttgcttttgaaagtctgcttcggtctaacctggaacctgag
ctatacaatttcagaatattgaatgagtttgtttcttttctgcatactcatcatagtcag
gaatataaaattcacctgaaaatagatacaggcatgcatcgtttaggttttcaggaagaa
gatatagataaactggtttccattttaaaagccaacccacatattaaagtagcatcggtg
ttttcccatttggctgccagcgaagatgcggaagaagacgggtttacacaaaaacagctt
gatttgtttttaagggtggctgataaactaaagcaattgttaggttatagttttatcagg
catatttgtaattcggcaggtattgtaagacaccccgaggctcatttagacatggttcgg
ttaggcctgggactttatggcattgatagtgctgtgaaaaataatcgtttgttacagccg
attggtacattaaaaactacgatcacacaaattaaggagttagcgccgggtgaaacggtg
agttataatcgaagaggaaaaataaatgtaccttcaaagattgcaaccgttaagctgggt
tatgcagacggattaagccgtaagttaggaaatggcgtgggtgaaatgcttgtaaacggt
aaaagagcaccaattattggcagtgtatgcatggatatgaccatgttaaacgtaaccgaa
attgattgtaaggaaacggatgaagttattgtttttaatgaagaacttcgggttgaagaa
ttggccgaaaaaatcggaacaattccatatgaggtgcttacagggatttctcagcgtgta
aaacgtgtgtatgtatatgaatag

DBGET integrated database retrieval system