KEGG   Solitalea canadensis: Solca_1617Help
Entry
Solca_1617        CDS       T02084                                 

Definition
(GenBank) beta-galactosidase/beta-glucuronidase
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
scn  Solitalea canadensis
Pathway
scn00052  Galactose metabolism
scn00511  Other glycan degradation
scn00600  Sphingolipid metabolism
scn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Solca_1617
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    Solca_1617
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Solca_1617
Enzymes [BR:scn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Solca_1617
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_2_N Glyco_hydro_2_C DUF4982 Glyco_hydro_2 BetaGal_dom4_5 Big_1 Invasin_D3 DUF4325
Motif
Other DBs
NCBI-ProteinID: AFD06684
UniProt: H8KVR1
LinkDB All DBs
Position
1954283..1956706
Genome map
AA seq 807 aa AA seqDB search
MQKLKYLSYLLLLTILSQTVNGQTNTRTVENLNKGWKFYLGDEVKASNPDFNDQNWRSLN
VPHDWSVEGSFSKDHPATPGGGALPGGTGWYRKTFIIPATSKGKSVFIDFDGVYRNSEVW
INGHLLGKRPNGYIAFRYDLTPFLLYGKKNVLAVKVDNSEQPNSRWYSGSGIYRDVKLTT
VNHVFVDLWGTQVRTPKVTSEIANVSIKTQIRNNSTAVQQGVVKTSLVNAEGKVVTSTAT
KITLKDSISFVEQLLSVSNPHLWSDTDPYLYKVVTTILLGNKTVDQYETTAGLRYFSFDK
DKGFSLNGKPLKIRGVCNHHDLGALGAAFNVRAAERQLEMLKEMGCNGLRTSHNPPAEEL
LNLCDKMGFIVMNEAFDMWKKGKNKYDYSLDWDKWHKRDLEDQIKRDRNHPSVFMWSIGN
EIQEQWGTGADTAGRVITRELTAIVKSLDDRPVTSATNDINLYNNLIFSNAYDLIGYNYN
HDKFAKFPQTFPGKQLIGSETVSALQTRGHYDMPSDSIRVWPTAWDKPLLTGNADLTCSA
YDNCRTPWGSTHEETLCEFNTNQHLAGMFIWTGFDYLGEPTPYPWPARSSYFGIIDLAGF
PKDVFYMYQSQWTNTPVLHIFPHWNWKPGQLVDVWAYYNNADEVELFLNGKSLGSKKKVQ
HEFHVYWRIPFEAGTIKAVSRKNGVTVLTKEITTTGTPSKIILTADRNKIKADGEDLSFI
TAKIADEKGNMIPNADNLIQFTVSGDASIAGVDNGNPTSMESFKASQRKAFNGLALAILK
SGEKSGKVTFTATAQGLVPASIEIEVK
NT seq 2424 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaattgaaatacctgagttatctgttgttgctaacgatacttagccaaacagtg
aatggtcaaaccaacaccagaactgtagaaaatcttaataaaggctggaaattctatctg
ggagatgaagtaaaagcaagtaatcctgattttaatgatcagaactggcgtagcttaaat
gtacctcatgattggagtgttgaaggctcatttagtaaggatcatccggcaacacctgga
ggaggagcacttccgggtggaaccggttggtaccgtaaaacatttataatacccgcaaca
agtaaaggtaaatcggtatttattgactttgacggcgtttatcgtaatagtgaggtgtgg
atcaatggtcatttattagggaaaagacctaatggctatatcgctttcaggtatgatctt
acacctttcttactatatggaaaaaagaatgtgcttgcggtaaaagttgataattccgag
cagcctaactcacgctggtattctggttcgggtatctatcgtgatgttaaacttaccact
gttaaccacgtttttgttgatttgtggggaacacaggttagaactccaaaagtaaccagt
gaaattgctaatgtgtcaattaaaacccaaatcaggaataacagcactgctgttcaacag
ggtgttgttaaaacttcgctggtaaatgcagagggtaaagtagtgacgtcaaccgctact
aaaattacgttaaaagattcgatatcatttgttgagcaattgctttctgtatccaatcct
catttatggtctgatacagatccttatttatacaaggtggtcacaactattctgctggga
aataaaacagttgatcagtatgaaaccacggcgggacttcgttatttttcatttgataag
gataaaggtttttcattgaatggtaagccattgaaaatacgtggcgtttgcaatcatcat
gatttaggggctttaggcgcagcatttaacgtacgagctgctgagcgtcaactggaaatg
ctgaaagaaatgggttgtaacggtttgcggacttcccataatccgcctgctgaagaatta
ctgaatctatgtgataaaatgggctttatcgtaatgaacgaagcctttgatatgtggaag
aagggaaagaataaatacgattacagccttgattgggacaaatggcataaacgtgatctt
gaagatcagattaagcgtgatcgtaatcatccaagtgttttcatgtggagcattggaaat
gagattcaggaacagtggggaacaggagcagacactgcaggaagagtgattacccgtgaa
ttgactgcaattgtaaaaagcctggatgatcgtccggttacatcagcaacaaatgatatt
aatctgtataacaatttgatcttttcaaacgcttatgatttgatcggttacaactataac
catgataaatttgccaagttccctcagacatttccaggtaagcaattaataggttctgaa
acagtttcagcattgcaaacccgtggccattatgatatgccctcagatagtatacgagtt
tggcctacagcatgggataaaccccttttaaccggaaatgcagatttaacctgctccgct
tatgataattgccgtacgccttggggatcaactcatgaagagacgttgtgtgagtttaat
actaaccaacatcttgccggtatgttcatctggacaggttttgactacctgggagagcct
actccatacccatggccagcacgtagttcctattttggaattatcgacctggcaggtttt
ccgaaagatgttttttacatgtatcaaagtcaatggacaaatactcctgtactgcacatt
tttcctcattggaactggaaacccggacaactggtagatgtttgggcttattacaacaat
gcggatgaagtagaactgtttttgaacggtaaatctttgggttcgaaaaagaaagtacag
catgagtttcatgtatactggcgaataccatttgaggcgggcaccattaaggcagtttcc
agaaaaaatggagttactgtattaacaaaagaaataacaacaactggtactccttcaaaa
attatcctgacagccgaccgcaataaaattaaggcagatggagaggacctttcttttata
acggccaaaatagcggacgaaaaagggaacatgattcccaatgcggataacctgattcaa
tttacggtaagtggagatgcttccatagccggagtagataatggaaatcctaccagcatg
gaatcatttaaggcaagtcagcgaaaagcatttaatggattggctttggccattttgaaa
tcaggagagaaaagcggtaaggtaacctttacagcaactgcacaaggactagtcccagcg
agtatagagattgaggttaaataa

DBGET integrated database retrieval system