KEGG   Solitalea canadensis: Solca_3306Help
Entry
Solca_3306        CDS       T02084                                 

Definition
(GenBank) Glycoside hydrolase 97
  KO
K21574  glucan 1,4-alpha-glucosidase [EC:3.2.1.3]
Organism
scn  Solitalea canadensis
Pathway
scn00500  Starch and sucrose metabolism
scn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Solca_3306
Enzymes [BR:scn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     Solca_3306
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_97 GH97_N GH97_C
Motif
Other DBs
NCBI-ProteinID: AFD08316
UniProt: H8KWY7
LinkDB All DBs
Position
complement(3895214..3897352)
Genome map
AA seq 712 aa AA seqDB search
MRKLLLSAVVLLAITISSSAQDLTSPNGNLKLSFKIQNGTPTYQLSYKGKEVVKTSKLGL
ELKEGASLLNGFDVRKADYNEANETWSPVWGEERTIRNHYKEMLVTLDQKAQKRFIQIRF
RLYNDGLGFRYEFPLQDSLNYFVIKEERTQFAMNGDHKAFWLPGDYDTQEYSTVTSNLSE
IRVKMKESITPNASQQPFSPTGVQTSLMMKSKDGLYINIHEAALVDYSCMHLNLDDKNMV
FESWLTPDAIGDKGYMQTPCKSPWRTVMVSDDAREILASKLILNLNDPCKYEDVSWIKPV
KYVGVWWEMITGKSTWAYNNLTSVKLGEIDYAKTQPNGKHAANTAHVKEYIDFAAENGLD
AVLVEGWNEGWEDWFGKNKDYVFDFLTPYPDFDVKGLHEYAKSKGVRLIMHHETSGSVRN
YERHMDKAYQFMVDNGYNAVKSGYVGNILPLGENHYNQYMVNHYLYAITKAAEYKIMVNA
HEAVRPTGLCRTYPNLIGNESARGTEYEAFGGSNPDHTTILPFTRLMGGPMDYTPGIFET
KISNVNPENKSYVRSTLSRQLALYVTMYSPLQMAADLVENYKKHMDAFQFIKDVAVDWDE
SKYLEAEPGDYITAARKAKGTNNWFVGCTSDENGHISNLTLNFLDPGKKYVATIYADAKD
AHYETNPQAYTIIKGIVTNKTKLTLKAAPGGGYAISIIEVTDKDALKGLKQF
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaactattattaagtgcggtggtgttattggccattacaataagttcatcagca
caagaccttacttccccgaacggtaatctaaagctatcttttaagattcagaatggaact
cctacttatcagttaagttataagggaaaagaggttgttaaaaccagtaaactagggtta
gagcttaaagaaggagcatcattattaaacggttttgatgttagaaaagctgattacaat
gaagcgaatgaaacttggtcgccagtttggggagaagagaggactattcgcaaccattac
aaagaaatgttggtgaccttagatcaaaaagcacaaaaaagattcatccaaatacgtttt
cgcttatataatgatggtttaggctttagatatgaattccctctgcaggatagtttgaat
tattttgttattaaagaagagagaacccaattcgcaatgaatggcgatcataaagcattt
tggcttccaggcgattacgatacacaagagtatagcactgtaacctccaatttgtcggaa
atcagggtaaagatgaaagaatccattactcctaatgcctctcaacagccattttcacct
accggtgttcaaacctcattaatgatgaaaagtaaagatggtttgtacattaatattcat
gaagcagcacttgtagactattcatgtatgcaccttaaccttgatgataaaaatatggtt
tttgaatcatggttaactcctgatgccataggtgataaaggatacatgcaaactccttgt
aaatccccttggcgtacagtaatggtaagtgatgatgcacgtgagattttagcatccaaa
ctgatccttaatcttaatgatccatgtaaatatgaagatgtgtcgtggatcaaacctgtt
aaatatgttggtgtatggtgggaaatgatcaccggtaaaagcacctgggcttataacaac
cttacctctgtaaaattaggagagattgattacgctaaaactcaacctaacggaaaacac
gcggcgaacactgctcatgttaaggagtatattgactttgccgctgaaaacggattagat
gcggtgttggttgaaggttggaatgaaggatgggaagattggttcggaaaaaacaaggac
tatgttttcgatttcttaactccatatccagatttcgatgttaaaggattgcatgagtat
gcaaaaagtaaaggggttcgactgatcatgcaccatgaaacttcaggttcagtaagaaac
tatgaaagacatatggataaagcgtatcagtttatggttgataatggctataatgctgtg
aaaagtggttatgtaggtaatattctcccgcttggggaaaaccattataaccaatatatg
gtcaatcattatttgtacgcgattaccaaagccgcggaatataaaatcatggtaaatgcc
catgaggctgttcgtcccaccggattgtgccgcacttatcctaacctgattgggaatgag
tctgctcgtggaacagaatacgaagcttttggaggaagtaatcctgatcatactacaatt
cttccgtttacccgcttaatgggcggtccgatggattatacacctggaatctttgaaaca
aagatcagtaacgttaaccctgagaataaatcttatgtacgtagtactttaagtcgccag
ttagcattgtacgttacgatgtacagtccattgcaaatggctgctgatttagttgaaaac
tataagaagcacatggatgcattccagtttataaaagatgttgcggttgactgggatgaa
agcaagtatttagaggctgagcctggagattatattactgctgctcgtaaggcaaaagga
acaaataattggtttgttgggtgcaccagcgatgaaaatggacatatatctaatttgacg
cttaatttccttgatccgggtaagaaatacgttgcaactatttatgcggatgcaaaggat
gctcattatgaaaccaatcctcaggcatatacgattatcaaaggaattgtaacgaataaa
accaaattaacacttaaagcagctccgggaggaggttatgctattagcataatcgaagta
accgataaagacgctttgaaagggttaaaacaattctaa

DBGET integrated database retrieval system